Homologs in group_1477

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08775 FBDBKF_08775 100.0 Morganella morganii S1 yhbP YhbP family protein
EHELCC_12750 EHELCC_12750 100.0 Morganella morganii S2 yhbP YhbP family protein
LHKJJB_13465 LHKJJB_13465 100.0 Morganella morganii S3 yhbP YhbP family protein
HKOGLL_11565 HKOGLL_11565 100.0 Morganella morganii S5 yhbP YhbP family protein
F4V73_RS09990 F4V73_RS09990 81.6 Morganella psychrotolerans - YhbP family protein
PMI_RS17180 PMI_RS17180 54.2 Proteus mirabilis HI4320 - YhbP family protein

Distribution of the homologs in the orthogroup group_1477

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1477

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MZ10 2.08e-58 181 58 0 134 3 plu4501 UPF0306 protein plu4501 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1CM28 2.16e-58 181 58 1 143 3 YPN_0620 UPF0306 protein YPN_0620 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R5D1 2.16e-58 181 58 1 143 3 YpAngola_A4021 UPF0306 protein YpAngola_A4021 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBE9 2.16e-58 181 58 1 143 3 YPO3467 UPF0306 protein YPO3467/y0717/YP_0616 Yersinia pestis
A4TQS2 2.16e-58 181 58 1 143 3 YPDSF_3277 UPF0306 protein YPDSF_3277 Yersinia pestis (strain Pestoides F)
Q1C3P1 2.16e-58 181 58 1 143 3 YPA_2969 UPF0306 protein YPA_2969 Yersinia pestis bv. Antiqua (strain Antiqua)
B1JLV4 3.04e-58 180 57 1 143 3 YPK_3704 UPF0306 protein YPK_3704 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B2K2T1 6.83e-58 179 57 1 143 3 YPTS_0536 UPF0306 protein YPTS_0536 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66F34 6.83e-58 179 57 1 143 3 YPTB0506 UPF0306 protein YPTB0506 Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FMP6 6.83e-58 179 57 1 143 3 YpsIP31758_3570 UPF0306 protein YpsIP31758_3570 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JIZ7 1.59e-57 179 58 1 146 3 YE0465 UPF0306 protein YE0465 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8G928 1.28e-55 174 56 0 137 3 Spro_0510 UPF0306 protein Spro_0510 Serratia proteamaculans (strain 568)
A6TEH3 8.02e-49 156 52 0 135 3 KPN78578_35330 UPF0306 protein KPN78578_35330 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSY9 4.27e-48 155 51 0 135 3 KPK_0562 UPF0306 protein KPK_0562 Klebsiella pneumoniae (strain 342)
A8AQ39 3.11e-45 147 51 0 135 3 CKO_04548 UPF0306 protein CKO_04548 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7NKM3 2.53e-44 145 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5BGI2 3.08e-44 145 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella paratyphi A (strain AKU_12601)
Q5PL88 3.62e-44 145 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B7LR07 3.91e-44 144 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LFQ5 4.32e-44 144 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain SMS-3-5 / SECEC)
P60822 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60821 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella typhi
A9N716 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T6Y5 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella newport (strain SL254)
B4TIZ3 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella heidelberg (strain SL476)
B5REM0 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZU2 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella enteritidis PT4 (strain P125109)
B5FHZ8 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella dublin (strain CT_02021853)
B5F6S3 5.31e-44 144 50 0 137 3 yhbP UPF0306 protein YhbP Salmonella agona (strain SL483)
Q8FD95 1.92e-43 142 49 0 135 3 yhbP UPF0306 protein YhbP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UJ49 1.92e-43 142 49 0 135 3 yhbP UPF0306 protein YhbP Escherichia coli O127:H6 (strain E2348/69 / EPEC)
C0PZ38 2.45e-43 142 49 0 137 3 yhbP UPF0306 protein YhbP Salmonella paratyphi C (strain RKS4594)
Q57JJ5 2.45e-43 142 49 0 137 3 yhbP UPF0306 protein YhbP Salmonella choleraesuis (strain SC-B67)
B7NDD8 3.18e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q32BH9 3.36e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Shigella dysenteriae serotype 1 (strain Sd197)
A7ZS49 3.36e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0TCV5 3.4e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N0T9 3.4e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O81 (strain ED1a)
Q3YX87 3.75e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Shigella sonnei (strain Ss046)
B2U2L3 3.79e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7M062 4e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O8 (strain IAI1)
P67763 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Shigella flexneri
Q0T0C7 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Shigella flexneri serotype 5b (strain 8401)
B6I1M9 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain SE11)
P67762 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain K12)
B1IQW7 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A4X0 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O9:H4 (strain HS)
B1XGW6 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain K12 / DH10B)
C4ZSP5 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain K12 / MC4100 / BW2952)
B7LH88 4.05e-43 142 48 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain 55989 / EAEC)
Q1R6I7 4.93e-43 142 47 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli (strain UTI89 / UPEC)
A1AG59 4.93e-43 142 47 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O1:K1 / APEC
B7MB75 4.93e-43 142 47 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O45:K1 (strain S88 / ExPEC)
A7MIN8 6.24e-43 141 49 0 136 3 ESA_03544 UPF0306 protein ESA_03544 Cronobacter sakazakii (strain ATCC BAA-894)
B5YS44 3.55e-42 140 47 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XA94 3.84e-42 139 47 0 141 3 yhbP UPF0306 protein YhbP Escherichia coli O157:H7
B4TWC4 3.88e-42 139 48 0 137 3 yhbP UPF0306 protein YhbP Salmonella schwarzengrund (strain CVM19633)
Q31W33 4.47e-42 139 47 0 141 3 yhbP UPF0306 protein YhbP Shigella boydii serotype 4 (strain Sb227)
A4WEW9 6.85e-42 139 48 0 135 3 Ent638_3591 UPF0306 protein Ent638_3591 Enterobacter sp. (strain 638)
A9MPN8 7.22e-42 139 47 0 138 3 yhbP UPF0306 protein YhbP Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q7VLR3 2.39e-27 102 37 1 136 3 HD_1359 UPF0306 protein HD_1359 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MSI8 1.68e-23 92 33 1 136 3 WS0399 UPF0306 protein WS0399 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9CJN9 8.88e-21 85 28 0 137 3 PM1958 UPF0306 protein PM1958 Pasteurella multocida (strain Pm70)
Q9PML1 1.93e-11 60 26 3 137 3 Cj1449c UPF0306 protein Cj1449c Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FNB6 1.93e-11 60 26 3 137 3 C8J_1355 UPF0306 protein C8J_1355 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13090
Feature type CDS
Gene yhbP
Product YhbP family protein
Location 28078 - 28521 (strand: -1)
Length 444 (nucleotides) / 147 (amino acids)
In genomic island -

Contig

Accession ZDB_528
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1477
Orthogroup size 7
N. genomes 7

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3787 Function unknown (S) S Uncharacterized conserved protein YhbP, UPF0306 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09979 uncharacterized protein - -

Protein Sequence

MELPHDSILSYLKKNHVVTLCATAGDDLWCASCFYVADTGAMMLYFLTEPHTRHGTLMQQNPLVAGTISAQTVTVAKIRGIQFRGEVTALSAEEEKQARAVYCRRFPVAVAAKTPLWGLRLDEIKMVNNTLGFGKKLHWSRFSADSE

Flanking regions ( +/- flanking 50bp)

CACCGGATGATATACTCTGTCAGCCGGTGTGGTTTTATTGGGGGTACTGTATGGAATTACCGCACGATTCAATCCTGTCTTATCTGAAGAAAAATCATGTCGTCACGCTGTGTGCCACTGCCGGTGATGACCTGTGGTGCGCTTCCTGCTTTTATGTCGCGGACACCGGCGCAATGATGCTTTATTTCCTCACTGAACCTCATACCCGGCACGGCACCCTGATGCAGCAGAACCCGCTGGTGGCGGGAACCATTTCCGCACAGACGGTTACCGTGGCAAAAATCCGCGGGATCCAGTTCAGAGGTGAGGTGACAGCGTTGTCAGCGGAAGAGGAAAAACAGGCGAGAGCCGTTTACTGCCGCCGCTTTCCGGTGGCTGTCGCCGCCAAAACCCCGTTGTGGGGGTTGCGGCTGGATGAGATAAAGATGGTGAATAATACGCTGGGGTTCGGAAAGAAACTGCACTGGTCGCGGTTCAGCGCAGATAGTGAATAACCTGATTTGCACTGCCGCGCCAGATCAGCATCGGGTCATGCAGATCCTGT