Homologs in group_1024

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05225 FBDBKF_05225 100.0 Morganella morganii S1 yciA acyl-CoA thioester hydrolase YciA
EHELCC_12365 EHELCC_12365 100.0 Morganella morganii S2 yciA acyl-CoA thioester hydrolase YciA
LHKJJB_12565 LHKJJB_12565 100.0 Morganella morganii S3 yciA acyl-CoA thioester hydrolase YciA
HKOGLL_11180 HKOGLL_11180 100.0 Morganella morganii S5 yciA acyl-CoA thioester hydrolase YciA
F4V73_RS05685 F4V73_RS05685 96.5 Morganella psychrotolerans yciA acyl-CoA thioester hydrolase YciA
PMI_RS06535 PMI_RS06535 79.7 Proteus mirabilis HI4320 yciA acyl-CoA thioester hydrolase YciA

Distribution of the homologs in the orthogroup group_1024

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1024

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1A1 1.22e-71 214 76 0 130 3 yciA Acyl-CoA thioester hydrolase YciA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1A2 1.22e-71 214 76 0 130 3 yciA Acyl-CoA thioester hydrolase YciA Salmonella typhi
P0A8Z2 1.76e-69 208 73 0 130 3 yciA Acyl-CoA thioester hydrolase YciA Shigella flexneri
P0A8Z0 1.76e-69 208 73 0 130 3 yciA Acyl-CoA thioester hydrolase YciA Escherichia coli (strain K12)
P0A8Z1 1.76e-69 208 73 0 130 3 yciA Acyl-CoA thioester hydrolase YciA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q89AL4 8.16e-62 189 69 0 122 3 bbp_254 Uncharacterized acyl-CoA thioester hydrolase bbp_254 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P42398 6.11e-60 184 64 0 129 3 BUsg_263 Uncharacterized acyl-CoA thioester hydrolase BUsg_263 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P44886 1.72e-59 184 68 0 121 1 HI_0827 Uncharacterized acyl-CoA thioester hydrolase HI_0827 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57362 3.38e-56 175 58 0 129 3 BU274 Uncharacterized acyl-CoA thioester hydrolase BU274 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O66120 1.98e-28 105 43 2 123 3 ZMO0511 Uncharacterized acyl-CoA thioester hydrolase ZMO0511 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q9Z7Q0 1.33e-15 72 32 2 125 3 CPn_0654 Uncharacterized acyl-CoA thioester hydrolase CPn_0654/CP_0093/CPj0654/CpB0680 Chlamydia pneumoniae
Q9PJK7 1.8e-13 66 31 1 113 3 TC_0822 Uncharacterized acyl-CoA thioester hydrolase TC_0822 Chlamydia muridarum (strain MoPn / Nigg)
O84540 6.41e-13 65 31 1 113 3 CT_535 Uncharacterized acyl-CoA thioester hydrolase CT_535 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q91V12 5.18e-12 65 32 3 132 1 Acot7 Cytosolic acyl coenzyme A thioester hydrolase Mus musculus
Q64559 6.42e-12 65 32 3 132 1 Acot7 Cytosolic acyl coenzyme A thioester hydrolase Rattus norvegicus
O00154 8.91e-11 61 32 3 132 1 ACOT7 Cytosolic acyl coenzyme A thioester hydrolase Homo sapiens
P49851 6.26e-10 57 32 1 107 3 ykhA Uncharacterized acyl-CoA thioester hydrolase YkhA Bacillus subtilis (strain 168)
P0A0Q7 1.14e-08 54 28 2 120 3 vdlD Protein VdlD Helicobacter pylori (strain ATCC 700392 / 26695)
P0A0Q8 1.14e-08 54 28 2 120 3 vdlD Protein VdlD Helicobacter pylori (strain J99 / ATCC 700824)
Q8WXI4 1.2e-05 47 27 1 109 1 ACOT11 Acyl-coenzyme A thioesterase 11 Homo sapiens
Q8VHQ9 2.21e-05 46 27 1 109 1 Acot11 Acyl-coenzyme A thioesterase 11 Mus musculus
Q3SWX2 2.41e-05 46 27 3 150 2 ACOT9 Acyl-coenzyme A thioesterase 9, mitochondrial Bos taurus

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_12705
Feature type CDS
Gene yciA
Product acyl-CoA thioester hydrolase YciA
Location 128396 - 128836 (strand: -1)
Length 441 (nucleotides) / 146 (amino acids)
In genomic island -

Contig

Accession ZDB_527
Length 181446 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1024
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03061 Thioesterase superfamily

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1607 Lipid transport and metabolism (I) I Acyl-CoA hydrolase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K10806 acyl-CoA thioesterase YciA [EC:3.1.2.-] Biosynthesis of unsaturated fatty acids -

Protein Sequence

MTQQQCLPNGELVLRTLTMPTDTNANGDIFGGWLMSQMDIGGAILAKEIALGRVVTVRVDGITFLRSVAVGDVVCCYARCLKTGNSSMTVKVEVWVKKVATDPIGDRYRATEAVFSYVAVDADNRPRPLPDGKRHFQLDSSNSDLK

Flanking regions ( +/- flanking 50bp)

GTTTGTTTCCGCCGGTATCCTTTTTCGTTAAACGGATGTAAGTGTTTCTCATGACTCAACAACAATGTTTACCTAACGGGGAACTGGTGCTGCGCACCTTAACCATGCCGACAGACACCAATGCCAACGGGGATATCTTCGGCGGCTGGCTGATGTCGCAAATGGATATCGGCGGCGCTATTCTGGCAAAGGAGATTGCACTCGGCCGCGTGGTGACCGTCCGCGTGGACGGCATTACCTTTCTGCGCTCTGTCGCGGTCGGTGATGTGGTCTGCTGTTATGCGCGCTGCCTGAAAACCGGGAATTCATCCATGACAGTCAAAGTTGAGGTCTGGGTGAAAAAAGTGGCTACCGATCCTATCGGTGACCGTTACCGGGCAACAGAAGCTGTCTTCAGTTATGTTGCGGTGGATGCGGATAACCGTCCCCGCCCGCTGCCCGACGGAAAACGTCATTTTCAGTTAGACAGCAGTAACAGTGATTTAAAATAATGCGTTTCATACCGGCCACTCTTCTGAGTGGCCGTTTTGTCTGCCGGAAT