Homologs in group_3254

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05715 FBDBKF_05715 100.0 Morganella morganii S1 rhtB homoserine/homoserine lactone efflux protein
EHELCC_11875 EHELCC_11875 100.0 Morganella morganii S2 rhtB homoserine/homoserine lactone efflux protein
LHKJJB_12075 LHKJJB_12075 100.0 Morganella morganii S3 rhtB homoserine/homoserine lactone efflux protein
HKOGLL_10690 HKOGLL_10690 100.0 Morganella morganii S5 rhtB homoserine/homoserine lactone efflux protein

Distribution of the homologs in the orthogroup group_3254

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3254

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AG37 4.46e-111 319 73 0 206 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 4.46e-111 319 73 0 206 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 4.46e-111 319 73 0 206 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 4.46e-111 319 73 0 206 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
Q9L6N6 6.53e-103 298 73 0 206 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3B4 4.3e-102 296 73 0 206 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
Q9KVK7 4.78e-67 207 50 0 201 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O05406 5.02e-14 70 32 3 139 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
A8AHJ0 3.02e-13 68 26 4 156 3 leuE Leucine efflux protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P38102 3.28e-13 68 31 3 141 3 PA4757 Uncharacterized membrane protein PA4757 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7CQP8 7.28e-13 67 28 4 154 3 leuE Leucine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV9 7.28e-13 67 28 4 154 3 leuE Leucine efflux protein Salmonella typhi
Q5PHF4 7.28e-13 67 28 4 154 3 leuE Leucine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57Q25 7.28e-13 67 28 4 154 3 leuE Leucine efflux protein Salmonella choleraesuis (strain SC-B67)
Q8XDS6 3.91e-12 65 27 4 154 3 leuE Leucine efflux protein Escherichia coli O157:H7
Q32FT6 4.28e-12 65 27 3 152 3 leuE Leucine efflux protein Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z2D8 5.2e-12 65 27 4 154 3 leuE Leucine efflux protein Shigella sonnei (strain Ss046)
A7ZMR9 5.2e-12 65 27 4 154 3 leuE Leucine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
P76249 5.3e-12 65 27 3 152 1 leuE Leucine efflux protein Escherichia coli (strain K12)
A8A0Z3 5.3e-12 65 27 3 152 3 leuE Leucine efflux protein Escherichia coli O9:H4 (strain HS)
A6T7N0 5.52e-12 65 29 2 137 3 leuE Leucine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1RAZ2 9.84e-12 64 28 5 155 3 leuE Leucine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FGV4 9.84e-12 64 28 5 155 3 leuE Leucine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH31 9.84e-12 64 28 5 155 3 leuE Leucine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABX2 9.84e-12 64 28 5 155 3 leuE Leucine efflux protein Escherichia coli O1:K1 / APEC
A4WB82 5.83e-09 57 26 2 135 3 leuE Leucine efflux protein Enterobacter sp. (strain 638)
Q321T8 8.25e-09 56 26 3 138 5 leuE Putative leucine efflux protein Shigella boydii serotype 4 (strain Sb227)
A7ZQ23 2.07e-07 52 27 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83K22 2.17e-07 52 27 7 157 3 eamB Cysteine/O-acetylserine efflux protein Shigella flexneri
Q0T1S8 2.17e-07 52 27 7 157 3 eamB Cysteine/O-acetylserine efflux protein Shigella flexneri serotype 5b (strain 8401)
Q3YYT7 2.2e-07 52 27 7 157 3 eamB Cysteine/O-acetylserine efflux protein Shigella sonnei (strain Ss046)
P38101 2.2e-07 52 27 7 157 1 eamB Cysteine/O-acetylserine efflux protein Escherichia coli (strain K12)
A8A390 2.2e-07 52 27 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O9:H4 (strain HS)
Q9L6N7 6.86e-07 51 25 2 137 3 rhtC Threonine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3B3 7.13e-07 51 25 2 137 3 rhtC Threonine efflux protein Salmonella typhi
Q1R8F4 7.23e-07 51 26 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FF11 7.23e-07 51 26 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TER0 7.23e-07 51 26 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEA8 7.23e-07 51 26 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O1:K1 / APEC
P75693 1.12e-06 50 27 1 122 3 yahN Uncharacterized membrane protein YahN Escherichia coli (strain K12)
Q31XQ6 2.23e-06 49 26 7 157 3 eamB Cysteine/O-acetylserine efflux protein Shigella boydii serotype 4 (strain Sb227)
Q8XA19 3.67e-06 49 26 7 157 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O157:H7
P0AG38 4.63e-06 48 25 2 131 1 rhtC Threonine efflux protein Escherichia coli (strain K12)
P0AG39 4.63e-06 48 25 2 131 3 rhtC Threonine efflux protein Escherichia coli O157:H7
P74343 5.3e-06 48 25 1 181 3 slr1627 Uncharacterized membrane protein slr1627 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8ZMX5 1.6e-05 47 28 8 159 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57L56 1.6e-05 47 28 8 159 3 eamB Cysteine/O-acetylserine efflux protein Salmonella choleraesuis (strain SC-B67)
Q8Z4J7 2.28e-05 47 28 8 159 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhi
Q5PNB4 2.28e-05 47 28 8 159 3 eamB Cysteine/O-acetylserine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A6T515 0.000201 44 27 0 79 3 eamB Cysteine/O-acetylserine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_12215
Feature type CDS
Gene rhtB
Product homoserine/homoserine lactone efflux protein
Location 32520 - 33140 (strand: -1)
Length 621 (nucleotides) / 206 (amino acids)
In genomic island -

Contig

Accession ZDB_527
Length 181446 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3254
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05834 homoserine/homoserine lactone efflux protein - -

Protein Sequence

MTFEWWFAYLMTSVIVSLSPGAGAINSMTTSVNHGYRGAIAAIAGLQTGLMMLIILVGVGLGTLLSQSVLAFEILKWAGAAYLIWLGIRQWRAAGTIELSAQAATLSRKKLYQNGVLVNISNPKSIVFLAALFPQFIMPHQPQLMQYLILGVTTVAADIIVMTGYAVLARQIAVFIKSPAQTRAMNKVFGSLFMLVGALLAFTRPA

Flanking regions ( +/- flanking 50bp)

GATGCCATAATCCGCACTTTATATTCTGTTAACAATCTGATGAGCTGAAAATGACCTTTGAGTGGTGGTTTGCCTATCTGATGACATCCGTAATTGTCAGTCTGTCTCCCGGCGCAGGTGCCATTAACAGCATGACGACGTCCGTCAATCACGGCTACCGGGGCGCGATTGCGGCCATTGCCGGGTTGCAGACCGGCCTGATGATGCTGATTATACTGGTCGGTGTCGGGCTGGGGACATTGTTGTCACAATCGGTTCTTGCTTTTGAAATACTGAAATGGGCAGGAGCGGCCTATCTTATCTGGCTGGGGATCCGCCAGTGGCGGGCAGCGGGAACTATTGAGCTGAGTGCACAGGCGGCAACGCTGTCACGCAAAAAGCTGTATCAGAATGGCGTACTGGTGAATATCTCGAACCCCAAAAGCATTGTTTTTCTCGCGGCGCTGTTTCCGCAGTTTATTATGCCGCACCAGCCCCAACTGATGCAGTATCTGATTCTGGGCGTCACCACCGTTGCCGCTGATATTATTGTCATGACAGGGTATGCCGTACTGGCACGGCAAATCGCGGTGTTTATCAAGAGCCCGGCACAGACCCGCGCCATGAATAAAGTGTTCGGATCATTATTTATGCTGGTCGGCGCCCTGCTGGCCTTTACCCGTCCGGCATGAGATAAACATATATAAATAACGCCCCGCATCATTATGGGGCGTTATAACTA