Homologs in group_1033

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05825 FBDBKF_05825 100.0 Morganella morganii S1 sufB Fe-S cluster assembly protein SufB
EHELCC_11765 EHELCC_11765 100.0 Morganella morganii S2 sufB Fe-S cluster assembly protein SufB
LHKJJB_11965 LHKJJB_11965 100.0 Morganella morganii S3 sufB Fe-S cluster assembly protein SufB
HKOGLL_10580 HKOGLL_10580 100.0 Morganella morganii S5 sufB Fe-S cluster assembly protein SufB
F4V73_RS03500 F4V73_RS03500 95.3 Morganella psychrotolerans sufB Fe-S cluster assembly protein SufB
PMI_RS06845 PMI_RS06845 86.6 Proteus mirabilis HI4320 sufB Fe-S cluster assembly protein SufB

Distribution of the homologs in the orthogroup group_1033

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1033

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P77522 0.0 866 83 2 492 1 sufB Iron-sulfur cluster assembly protein SufB Escherichia coli (strain K12)
Q83KW2 0.0 863 83 2 492 3 sufB Iron-sulfur cluster assembly protein SufB Shigella flexneri
Q55790 0.0 638 63 4 482 3 slr0074 Iron-sulfur cluster assembly SufBD family protein slr0074 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P48260 0.0 600 60 6 483 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 Cyanophora paradoxa
P51240 0.0 595 58 4 482 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 Porphyra purpurea
Q1XDP7 0.0 587 57 4 482 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 Neopyropia yezoensis
Q9ZS97 0.0 573 57 4 481 2 ABCI8 Iron-sulfur cluster assembly SufBD family protein ABCI8, chloroplastic Arabidopsis thaliana
P49530 0.0 562 54 5 499 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 Trieres chinensis
O78473 0.0 553 56 3 478 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 Guillardia theta
Q9TLX2 0.0 546 53 4 488 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 Cyanidium caldarium
Q02857 1.02e-137 401 62 1 297 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 (Fragment) Antithamnion sp.
Q3E8H7 3.53e-136 404 43 7 495 3 ABCI9 Iron-sulfur cluster assembly SufBD family protein ABCI9 Arabidopsis thaliana
Q49W57 4.19e-127 380 41 7 478 3 SSP1857 Iron-sulfur cluster assembly SufBD family protein SSP1857 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q2YWN2 7.43e-127 380 42 7 478 3 SAB0778 Iron-sulfur cluster assembly SufBD family protein SAB0778 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q6GIH0 8.2e-127 380 42 7 478 3 SAR0880 Iron-sulfur cluster assembly SufBD family protein SAR0880 Staphylococcus aureus (strain MRSA252)
Q5HHG8 1.52e-126 379 42 7 478 3 SACOL0918 Iron-sulfur cluster assembly SufBD family protein SACOL0918 Staphylococcus aureus (strain COL)
Q2FZY3 1.52e-126 379 42 7 478 3 SAOUHSC_00851 Iron-sulfur cluster assembly SufBD family protein SAOUHSC_00851 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q99VF9 1.52e-126 379 42 7 478 3 SAV0846 Iron-sulfur cluster assembly SufBD family protein SAV0846 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2FIF6 1.52e-126 379 42 7 478 3 SAUSA300_0822 Iron-sulfur cluster assembly SufBD family protein SAUSA300_0822 Staphylococcus aureus (strain USA300)
Q7A1E0 1.52e-126 379 42 7 478 3 MW0799 Iron-sulfur cluster assembly SufBD family protein MW0799 Staphylococcus aureus (strain MW2)
Q6GB09 1.52e-126 379 42 7 478 3 SAS0788 Iron-sulfur cluster assembly SufBD family protein SAS0788 Staphylococcus aureus (strain MSSA476)
Q7A6L4 1.52e-126 379 42 7 478 1 SA0778 Iron-sulfur cluster assembly SufBD family protein SA0778 Staphylococcus aureus (strain N315)
Q4L4T1 2.88e-126 379 42 7 478 3 SH2035 Iron-sulfur cluster assembly SufBD family protein SH2035 Staphylococcus haemolyticus (strain JCSC1435)
Q8CTA3 1.56e-125 377 41 7 478 3 SE_0610 Iron-sulfur cluster assembly SufBD family protein SE_0610 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQP8 2.38e-125 376 41 7 478 3 SERP0500 Iron-sulfur cluster assembly SufBD family protein SERP0500 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
O32162 2.43e-121 366 39 7 478 3 sufB Iron-sulfur cluster assembly protein SufB Bacillus subtilis (strain 168)
Q25799 2.44e-115 351 37 6 482 1 SufB Iron-sulfur cluster assembly protein SufB Plasmodium falciparum (isolate 3D7)
P35912 6.24e-103 310 67 1 221 3 ycf24 Iron-sulfur cluster assembly SufBD family protein ycf24 (Fragment) Galdieria sulphuraria
Q49689 4.43e-85 283 43 3 304 3 ML0593 Iron-sulfur cluster assembly SufBD family protein ML0593 Mycobacterium leprae (strain TN)
Q49689 2.1e-20 98 31 4 190 3 ML0593 Iron-sulfur cluster assembly SufBD family protein ML0593 Mycobacterium leprae (strain TN)
P67126 3.73e-63 223 39 3 258 3 BQ2027_MB1496 Iron-sulfur cluster assembly SufBD family protein Mb1496 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P67126 4.75e-42 163 37 5 241 3 BQ2027_MB1496 Iron-sulfur cluster assembly SufBD family protein Mb1496 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFP7 3.73e-63 223 39 3 258 1 Rv1461 Iron-sulfur cluster assembly SufBD family protein Rv1461 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFP7 4.75e-42 163 37 5 241 1 Rv1461 Iron-sulfur cluster assembly SufBD family protein Rv1461 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFP6 3.73e-63 223 39 3 258 3 MT1508 Iron-sulfur cluster assembly SufBD family protein MT1508 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WFP6 4.75e-42 163 37 5 241 3 MT1508 Iron-sulfur cluster assembly SufBD family protein MT1508 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O50093 8.99e-48 174 25 9 460 3 PH1385 Iron-sulfur cluster assembly SufBD family protein PH1385 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O32165 1.03e-39 152 23 6 444 3 sufD Iron-sulfur cluster assembly protein SufD Bacillus subtilis (strain 168)
Q50519 8.65e-24 106 25 8 393 3 None Iron-sulfur cluster assembly SufBD family protein MTH1150 homolog Methanothermobacter thermautotrophicus (strain Winter)
O27218 1.92e-23 105 25 8 385 3 MTH_1150 Iron-sulfur cluster assembly SufBD family protein MTH_1150 Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
O30305 2.56e-19 92 24 11 324 3 AF_2365 Iron-sulfur cluster assembly SufBD family protein AF_2365 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q9LQK7 4.72e-13 74 23 6 323 1 ABCI7 Protein ABCI7, chloroplastic Arabidopsis thaliana
Q55792 3.17e-12 72 20 8 310 3 slr0076 Iron-sulfur cluster assembly SufBD family protein slr0076 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P77689 9.22e-10 64 28 0 153 1 sufD Iron-sulfur cluster assembly protein SufD Escherichia coli (strain K12)
O58613 2.02e-05 50 27 2 101 3 PH0883 Iron-sulfur cluster assembly SufBD family protein PH0883 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q49682 2.73e-05 50 20 5 234 3 ML0594 Iron-sulfur cluster assembly SufBD family protein ML0594 Mycobacterium leprae (strain TN)
Q60349 0.000166 47 27 2 106 3 MJ0034 Iron-sulfur cluster assembly SufBD family protein MJ0034 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8IIW9 0.000254 47 21 7 246 1 SufD Iron-sulfur cluster assembly protein SufD Plasmodium falciparum (isolate 3D7)
P59973 0.000816 45 23 6 203 3 BQ2027_MB1497 Iron-sulfur cluster assembly SufBD family protein Mb1497 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFP4 0.000816 45 23 6 203 3 MT1509 Iron-sulfur cluster assembly SufBD family protein MT1509 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WFP5 0.000861 45 23 6 203 1 Rv1462 Iron-sulfur cluster assembly SufBD family protein Rv1462 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_12105
Feature type CDS
Gene sufB
Product Fe-S cluster assembly protein SufB
Location 12527 - 14011 (strand: 1)
Length 1485 (nucleotides) / 494 (amino acids)

Contig

Accession ZDB_527
Length 181446 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1033
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01458 SUF system FeS cluster assembly, SufBD
PF19295 SufBD protein N-terminal region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0719 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster assembly scaffold protein SufB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09014 Fe-S cluster assembly protein SufB - -

Protein Sequence

MSQSNAEIGEDVQTWLNDGRYKEGFFTNVATDELAKGINENVIRAISAKRNEPEWMLNFRLDAFQHWLGMEEPHWLKAKYPQLDYQDYSYYSAPSCGSCDDTCGSQPGAVQSPAGSFLTSEVEEAFEKLGVPVREGQAVAVDAIFDSVSVSTTYRDELKKHGVIFCSFGEAIHDYPELVQKYLGTVVSNHDNFFAALNSAVASDGTFVYVPKGVRCPMELSTYFRINAAKTGQFERTILIADEGSYVSYIEGCSAPVRDTYQLHAAVVEVIIHKDAEVKYSTVQNWFSGGDSEGGILNFVTKRALCEGENSKMSWTQSETGSAITWKYPSVILKGDNSVGEFFSVALTNGTQQADTGTKMIHIGRNTKSTIISKGISAGKSQNSYRGLVKVLPGAENARNFTQCDSMLIGTECGAHTFPYVEVMNNSAQLEHEATTSRIGEDQLFYCLQRGISEDDAISMIVNGFCKDVFSELPLEFAVEAQKLLAISLEHSVG

Flanking regions ( +/- flanking 50bp)

ATGCCTGCGGGTGTGGTGAAAGCTTCGGGGTTTAAGAGCGAAGCCATATTATGTCTCAGAGCAATGCAGAGATTGGTGAAGACGTCCAGACCTGGCTGAATGACGGACGCTATAAAGAGGGCTTCTTCACTAACGTCGCCACGGATGAACTGGCGAAAGGGATCAATGAAAATGTGATCCGCGCCATTTCCGCCAAACGAAATGAACCGGAGTGGATGCTCAATTTCCGGCTGGACGCTTTTCAGCACTGGCTGGGGATGGAAGAACCGCACTGGCTGAAGGCGAAGTATCCGCAGCTGGATTATCAGGATTACAGCTATTACTCCGCGCCGTCATGCGGCTCGTGTGATGATACCTGCGGCTCACAGCCGGGGGCGGTGCAAAGCCCGGCGGGCAGTTTCCTGACCAGTGAAGTGGAAGAAGCCTTTGAAAAACTCGGCGTGCCGGTTCGCGAAGGGCAGGCGGTGGCAGTCGATGCGATTTTTGACTCCGTATCCGTCTCAACCACTTACCGTGATGAGCTGAAAAAACACGGCGTGATTTTCTGCTCGTTCGGGGAAGCGATTCACGACTATCCGGAACTGGTGCAGAAATACCTCGGTACCGTGGTATCCAATCACGATAACTTTTTTGCCGCGCTTAACTCAGCGGTTGCCTCTGACGGCACCTTTGTTTATGTCCCGAAAGGGGTGCGCTGCCCGATGGAGCTATCCACCTATTTCCGTATTAACGCGGCCAAAACCGGCCAGTTTGAACGCACCATCCTGATTGCGGATGAAGGCAGTTACGTCAGCTATATTGAGGGCTGCTCCGCACCGGTGCGTGACACTTATCAGCTGCATGCGGCGGTTGTGGAAGTGATCATCCATAAAGATGCGGAAGTGAAGTATTCCACAGTTCAGAACTGGTTCTCCGGCGGTGACAGCGAAGGCGGCATCCTCAACTTTGTCACAAAGCGGGCACTGTGTGAGGGGGAAAATTCAAAAATGTCGTGGACACAGTCTGAAACCGGCTCGGCCATCACCTGGAAATACCCGAGTGTGATCCTTAAAGGGGATAACTCTGTCGGCGAATTCTTCTCTGTTGCCCTGACCAACGGCACACAGCAGGCGGATACCGGTACCAAGATGATCCACATCGGCCGCAATACCAAGTCCACCATTATCTCGAAAGGGATTTCCGCTGGGAAAAGCCAGAACAGCTACCGGGGGCTGGTGAAGGTGCTGCCGGGTGCGGAAAACGCCCGTAACTTTACTCAGTGTGACTCTATGCTGATCGGCACAGAGTGCGGCGCACACACTTTCCCGTATGTGGAAGTGATGAATAACAGTGCGCAACTGGAGCATGAGGCCACCACGTCGCGTATCGGTGAAGACCAGCTGTTTTACTGCTTACAGCGCGGTATCAGCGAAGATGACGCCATCTCAATGATTGTAAACGGTTTTTGTAAAGACGTGTTCTCTGAGCTGCCGCTGGAATTTGCCGTGGAAGCACAGAAACTGCTGGCGATAAGCCTGGAACACAGTGTCGGTTAATCCATCAGAATCAGCGCCTGCGGGATAACCGGCGGGACGGAGTAGTACAT