Homologs in group_2025

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15190 FBDBKF_15190 100.0 Morganella morganii S1 gpt xanthine phosphoribosyltransferase
EHELCC_11055 EHELCC_11055 100.0 Morganella morganii S2 gpt xanthine phosphoribosyltransferase
LHKJJB_11260 LHKJJB_11260 100.0 Morganella morganii S3 gpt xanthine phosphoribosyltransferase
HKOGLL_09870 HKOGLL_09870 100.0 Morganella morganii S5 gpt xanthine phosphoribosyltransferase
F4V73_RS12255 F4V73_RS12255 96.1 Morganella psychrotolerans gpt xanthine phosphoribosyltransferase
PMI_RS01750 PMI_RS01750 86.2 Proteus mirabilis HI4320 gpt xanthine phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_2025

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2025

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N7B4 5.21e-99 284 88 0 151 3 gpt Xanthine-guanine phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EUU7 3.92e-98 281 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Proteus mirabilis (strain HI4320)
Q6D1I0 1.84e-97 280 88 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3Z599 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella sonnei (strain Ss046)
P0A9M7 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella flexneri
Q0T7Q9 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella flexneri serotype 5b (strain 8401)
Q32J21 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q325P8 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella boydii serotype 4 (strain Sb227)
B1LHT4 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I018 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain SE11)
B7N8G9 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A9M5 1.88e-97 280 86 0 152 1 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain K12)
B1J0Z6 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZWK1 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
B1XDY1 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZT95 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M267 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
B5Z1I2 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A9M6 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O157:H7
B7L3Z0 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZHZ7 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AKQ0 1.88e-97 280 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0A277 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A278 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella typhi
B4TZ85 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
B5BDQ2 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
C0Q6T6 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
A9MY09 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PF80 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVV9 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella newport (strain SL254)
B4T7Q0 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella heidelberg (strain SL476)
B5R5R4 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R4S1 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FJW9 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
Q57ST7 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella choleraesuis (strain SC-B67)
A9MNR9 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EWK0 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella agona (strain SL483)
B7LNG2 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8FKM7 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TL78 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MQ74 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
B7UJC6 4.42e-97 279 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RFT3 6.35e-97 278 85 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain UTI89 / UPEC)
A1A7U9 6.35e-97 278 85 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O1:K1 / APEC
B7MC88 6.35e-97 278 85 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
A6T532 7.66e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y1E0 7.66e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Klebsiella pneumoniae (strain 342)
A4W6X0 1.08e-96 278 87 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Enterobacter sp. (strain 638)
C6DCY0 1.78e-96 277 86 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7NK87 1.9e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B2U3S9 2.2e-96 277 88 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1JIH6 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DZ2 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPK4 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis (strain Pestoides F)
Q1CLD0 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2X4 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC05 8.46e-96 276 83 0 152 1 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis
B2K658 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4E3 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLI5 8.46e-96 276 83 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GAD0 1.11e-95 275 87 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Serratia proteamaculans (strain 568)
B2VHN3 7.94e-95 273 83 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C5B9M4 8.95e-95 273 85 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Edwardsiella ictaluri (strain 93-146)
A7MEN2 2.28e-94 272 85 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NVF2 2.46e-92 267 80 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Sodalis glossinidius (strain morsitans)
A1JNY0 2.84e-91 264 80 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6LTX6 7.82e-87 253 75 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Photobacterium profundum (strain SS9)
Q65QN6 7.66e-86 251 76 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VKR2 6.36e-85 248 75 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A3MYX7 1.29e-83 245 75 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CL73 1.8e-83 244 74 1 151 3 gpt Xanthine-guanine phosphoribosyltransferase Pasteurella multocida (strain Pm70)
C3LQ49 1.58e-81 239 73 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPT5 1.58e-81 239 73 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y8 1.58e-81 239 73 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7VKP2 3.65e-81 239 72 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B6EIE9 4.73e-80 236 71 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Aliivibrio salmonicida (strain LFI1238)
B0UWV5 4.74e-80 236 70 1 152 3 gpt Xanthine-guanine phosphoribosyltransferase Histophilus somni (strain 2336)
Q0I1C0 4.74e-80 236 70 1 152 3 gpt Xanthine-guanine phosphoribosyltransferase Histophilus somni (strain 129Pt)
Q5E6W3 5.46e-79 233 70 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A7MWU9 5.71e-79 233 69 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
A4SJF2 2.1e-78 232 69 1 154 3 gpt Xanthine-guanine phosphoribosyltransferase Aeromonas salmonicida (strain A449)
Q4QMM6 6.09e-78 231 69 2 153 3 gpt2 Xanthine-guanine phosphoribosyltransferase 2 Haemophilus influenzae (strain 86-028NP)
Q89AN2 8.27e-78 230 68 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q87RV3 1.14e-77 230 67 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P43859 1.46e-77 230 69 2 153 3 gpt1 Xanthine-guanine phosphoribosyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QMP2 1.46e-77 230 69 2 153 3 gpt1 Xanthine-guanine phosphoribosyltransferase 1 Haemophilus influenzae (strain 86-028NP)
B7VJB5 2.4e-77 229 67 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
Q7MN62 6.02e-77 228 67 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q8DF90 6.02e-77 228 67 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
Q8K9R8 2.64e-76 226 69 2 151 3 gpt Xanthine-guanine phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57339 4.68e-75 223 67 2 151 3 gpt Xanthine-guanine phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
A0KNR2 1.58e-74 222 65 1 154 3 gpt Xanthine-guanine phosphoribosyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5QW45 9.96e-58 180 54 2 154 3 gpt Xanthine-guanine phosphoribosyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q311U1 2.88e-57 179 52 0 151 3 gpt Xanthine-guanine phosphoribosyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1QVR0 6.25e-57 178 52 1 150 3 gpt Xanthine-guanine phosphoribosyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1VES8 1.44e-55 174 54 1 149 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q72D63 4.74e-55 173 53 1 149 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q6AQG4 6.81e-53 167 51 1 146 3 gpt Xanthine-guanine phosphoribosyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q11IP4 2.2e-52 166 51 3 156 3 gpt Xanthine-guanine phosphoribosyltransferase Chelativorans sp. (strain BNC1)
Q3SQJ9 2.62e-51 164 47 1 157 3 gpt Xanthine-guanine phosphoribosyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q98NH3 1.81e-50 161 51 4 158 3 gpt Xanthine-guanine phosphoribosyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q2IV51 2.18e-50 161 48 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain HaA2)
Q8G0P3 3.46e-50 160 49 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella suis biovar 1 (strain 1330)
A9MB59 3.46e-50 160 49 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A6X0U5 4.6e-50 160 49 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A6U9A2 2.19e-49 159 49 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Sinorhizobium medicae (strain WSM419)
B0CGJ6 2.91e-49 158 48 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
Q212I9 1.38e-48 157 47 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain BisB18)
Q92PU1 1.58e-48 157 49 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhizobium meliloti (strain 1021)
Q89IM4 6.04e-47 153 46 2 160 3 gpt Xanthine-guanine phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1QK75 1.06e-46 152 45 2 157 3 gpt Xanthine-guanine phosphoribosyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q5LRI5 1.42e-46 152 45 3 152 3 gpt Xanthine-guanine phosphoribosyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2K9D7 7.48e-46 150 48 3 154 3 gpt Xanthine-guanine phosphoribosyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6N7S7 8.52e-46 150 46 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q138L1 9.33e-46 150 45 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain BisB5)
Q3J3Y6 3.2e-45 148 44 2 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PIG2 3.2e-45 148 44 2 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WRD6 3.53e-45 148 44 2 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q28PG8 2.86e-44 146 45 4 157 3 gpt Xanthine-guanine phosphoribosyltransferase Jannaschia sp. (strain CCS1)
Q5FUI1 9.7e-44 144 48 3 148 3 gpt Xanthine-guanine phosphoribosyltransferase Gluconobacter oxydans (strain 621H)
Q1MHW9 2.53e-43 143 45 3 154 3 gpt Xanthine-guanine phosphoribosyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q1GHI7 5.66e-43 143 44 4 157 3 gpt Xanthine-guanine phosphoribosyltransferase Ruegeria sp. (strain TM1040)
Q163Y8 1.59e-42 142 45 4 157 3 gpt Xanthine-guanine phosphoribosyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8UEM6 9.42e-42 139 44 3 154 3 gpt Xanthine-guanine phosphoribosyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8YH64 3.06e-38 130 50 3 128 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YQ27 3.06e-38 130 50 3 128 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella abortus (strain 2308)
P18134 1.5e-08 54 30 8 142 3 hpt Hypoxanthine phosphoribosyltransferase Vibrio harveyi
Q8E2H3 8.47e-06 47 32 9 138 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Y1 8.47e-06 47 32 9 138 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype III (strain NEM316)
O33799 9.36e-06 46 30 6 125 1 hpt Hypoxanthine phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9M4 1.09e-05 46 30 5 116 3 hpt Hypoxanthine phosphoribosyltransferase Shigella flexneri
P0A9M2 1.09e-05 46 30 5 116 1 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli (strain K12)
P0A9M3 1.09e-05 46 30 5 116 3 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q839B2 2.06e-05 45 27 10 161 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5M6K8 2.33e-05 45 31 11 162 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M216 2.33e-05 45 31 11 162 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain CNRZ 1066)
P57291 0.000152 43 27 7 132 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8DWM8 0.000351 42 31 7 123 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q92F56 0.00074 42 29 7 141 3 tilS/hprT Bifunctional protein TilS/HprT Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8DRP8 0.00075 41 26 7 160 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97TC4 0.00075 41 26 7 160 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_11400
Feature type CDS
Gene gpt
Product xanthine phosphoribosyltransferase
Location 35454 - 35912 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession ZDB_526
Length 188522 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2025
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00156 Phosphoribosyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2236 Coenzyme transport and metabolism (H) H Hypoxanthine phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00769 xanthine phosphoribosyltransferase [EC:2.4.2.22] Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Nucleotide metabolism
-

Protein Sequence

MSEKYVVTWDMLQMHARKLAQRLMPTEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDHQRDMKVLKKADGDGEGFIIVDDLVDTGGTAQMIRDMYPKAHFVTIFAKPAGRPLVDDYVVDIPQDTWIEQPWDMTVSFVKPICDQ

Flanking regions ( +/- flanking 50bp)

CCGCAAAAAAGACTCTTTTCTGTAAATCATCAAGCCGGGATCAATCTGATATGAGCGAAAAATACGTCGTAACGTGGGATATGTTGCAAATGCATGCCCGTAAACTGGCACAGCGTTTAATGCCAACCGAACAATGGAAAGGCATCATCGCCGTAAGCCGCGGTGGTCTGGTGCCGGGTGCCTTACTCGCTCGTGAACTGGGTATCCGTCATGTGGATACTGTCTGCATTTCCAGCTATGATCATGACCATCAGCGCGATATGAAAGTTCTGAAAAAAGCCGACGGTGACGGCGAAGGATTTATCATTGTTGATGATCTGGTGGACACCGGTGGTACTGCTCAGATGATCCGCGATATGTATCCGAAAGCGCATTTCGTCACTATTTTTGCCAAACCGGCCGGACGTCCGCTGGTTGACGATTATGTGGTTGATATCCCGCAGGATACCTGGATCGAACAGCCGTGGGATATGACCGTCAGTTTTGTTAAACCAATCTGCGATCAGTAAGCGAATGCCATGACACAACAGAACCTGTCAGAGAAACTGTTTAAGCCGAA