Homologs in group_2025

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15190 FBDBKF_15190 96.1 Morganella morganii S1 gpt xanthine phosphoribosyltransferase
EHELCC_11055 EHELCC_11055 96.1 Morganella morganii S2 gpt xanthine phosphoribosyltransferase
NLDBIP_11400 NLDBIP_11400 96.1 Morganella morganii S4 gpt xanthine phosphoribosyltransferase
LHKJJB_11260 LHKJJB_11260 96.1 Morganella morganii S3 gpt xanthine phosphoribosyltransferase
HKOGLL_09870 HKOGLL_09870 96.1 Morganella morganii S5 gpt xanthine phosphoribosyltransferase
PMI_RS01750 PMI_RS01750 84.9 Proteus mirabilis HI4320 gpt xanthine phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_2025

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2025

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N7B4 2.72e-100 287 88 0 151 3 gpt Xanthine-guanine phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D1I0 1.44e-98 283 89 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4W6X0 1.68e-97 280 88 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Enterobacter sp. (strain 638)
B4EUU7 1.82e-97 280 84 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Proteus mirabilis (strain HI4320)
A6T532 2.32e-97 280 87 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y1E0 2.32e-97 280 87 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Klebsiella pneumoniae (strain 342)
C6DCY0 5.51e-97 279 87 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q3Z599 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella sonnei (strain Ss046)
P0A9M7 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella flexneri
Q0T7Q9 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella flexneri serotype 5b (strain 8401)
Q32J21 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q325P8 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella boydii serotype 4 (strain Sb227)
B1LHT4 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B6I018 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain SE11)
B7N8G9 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A9M5 7.17e-97 278 86 0 152 1 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain K12)
B1J0Z6 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZWK1 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
B1XDY1 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZT95 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M267 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
B5Z1I2 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A9M6 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O157:H7
B7L3Z0 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZHZ7 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AKQ0 7.17e-97 278 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LNG2 1.76e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0A277 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A278 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella typhi
B4TZ85 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
B5BDQ2 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
C0Q6T6 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
A9MY09 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PF80 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SVV9 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella newport (strain SL254)
B4T7Q0 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella heidelberg (strain SL476)
B5R5R4 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R4S1 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FJW9 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
Q57ST7 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella choleraesuis (strain SC-B67)
A9MNR9 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EWK0 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Salmonella agona (strain SL483)
Q8FKM7 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TL78 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MQ74 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
B7UJC6 1.8e-96 277 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RFT3 2.7e-96 277 85 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli (strain UTI89 / UPEC)
A1A7U9 2.7e-96 277 85 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O1:K1 / APEC
B7MC88 2.7e-96 277 85 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B2U3S9 7.5e-96 276 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7NK87 8.28e-96 276 86 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A8GAD0 1.24e-95 275 87 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Serratia proteamaculans (strain 568)
A7MEN2 1.93e-95 275 84 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B2VHN3 9.67e-95 273 83 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JIH6 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DZ2 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPK4 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis (strain Pestoides F)
Q1CLD0 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R2X4 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC05 1.52e-94 273 82 0 152 1 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis
B2K658 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4E3 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLI5 1.52e-94 273 82 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C5B9M4 2.9e-94 272 84 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Edwardsiella ictaluri (strain 93-146)
A1JNY0 3.87e-91 264 80 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NVF2 1.26e-90 263 78 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Sodalis glossinidius (strain morsitans)
Q6LTX6 3.79e-87 254 76 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Photobacterium profundum (strain SS9)
A6VKR2 2.73e-85 249 75 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65QN6 5.95e-85 248 74 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CL73 8.85e-84 245 73 1 153 3 gpt Xanthine-guanine phosphoribosyltransferase Pasteurella multocida (strain Pm70)
A3MYX7 1.32e-83 245 74 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VKP2 3.65e-81 239 70 0 151 3 gpt Xanthine-guanine phosphoribosyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C3LQ49 1.97e-80 237 73 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPT5 1.97e-80 237 73 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y8 1.97e-80 237 73 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B0UWV5 1.99e-79 234 69 1 152 3 gpt Xanthine-guanine phosphoribosyltransferase Histophilus somni (strain 2336)
Q0I1C0 1.99e-79 234 69 1 152 3 gpt Xanthine-guanine phosphoribosyltransferase Histophilus somni (strain 129Pt)
B6EIE9 2.06e-79 234 71 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Aliivibrio salmonicida (strain LFI1238)
A4SJF2 1.24e-78 233 68 1 154 3 gpt Xanthine-guanine phosphoribosyltransferase Aeromonas salmonicida (strain A449)
Q5E6W3 2.1e-78 232 70 0 152 3 gpt Xanthine-guanine phosphoribosyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q4QMM6 4.29e-78 231 69 2 153 3 gpt2 Xanthine-guanine phosphoribosyltransferase 2 Haemophilus influenzae (strain 86-028NP)
A7MWU9 7.5e-78 230 68 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
P43859 1.27e-77 230 68 2 153 3 gpt1 Xanthine-guanine phosphoribosyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QMP2 1.27e-77 230 68 2 153 3 gpt1 Xanthine-guanine phosphoribosyltransferase 1 Haemophilus influenzae (strain 86-028NP)
Q89AN2 2.27e-77 229 66 0 150 3 gpt Xanthine-guanine phosphoribosyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B7VJB5 2.32e-76 227 66 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
Q87RV3 3.36e-76 226 65 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MN62 1.35e-75 225 65 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q8DF90 1.35e-75 225 65 0 149 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
P57339 1.84e-75 224 68 2 151 3 gpt Xanthine-guanine phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K9R8 1.16e-74 222 67 2 151 3 gpt Xanthine-guanine phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A0KNR2 1.23e-74 222 64 1 154 3 gpt Xanthine-guanine phosphoribosyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5QW45 2.44e-57 179 53 2 154 3 gpt Xanthine-guanine phosphoribosyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q1QVR0 2.2e-56 176 52 1 150 3 gpt Xanthine-guanine phosphoribosyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q311U1 6.42e-56 175 50 0 151 3 gpt Xanthine-guanine phosphoribosyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1VES8 2.73e-54 171 53 1 149 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q72D63 1.08e-53 169 53 1 149 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q6AQG4 3.82e-53 168 52 1 146 3 gpt Xanthine-guanine phosphoribosyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q3SQJ9 2.85e-51 164 46 1 157 3 gpt Xanthine-guanine phosphoribosyltransferase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q11IP4 2.96e-51 164 50 3 156 3 gpt Xanthine-guanine phosphoribosyltransferase Chelativorans sp. (strain BNC1)
Q98NH3 2.55e-50 161 50 4 158 3 gpt Xanthine-guanine phosphoribosyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8G0P3 4.7e-50 160 47 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella suis biovar 1 (strain 1330)
A9MB59 4.7e-50 160 47 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2IV51 3.77e-49 158 46 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain HaA2)
B0CGJ6 3.79e-49 158 47 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A6X0U5 9.58e-49 157 47 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q212I9 1.66e-48 157 46 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain BisB18)
A6U9A2 3.92e-48 155 47 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Sinorhizobium medicae (strain WSM419)
Q92PU1 2.56e-47 154 47 3 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhizobium meliloti (strain 1021)
Q89IM4 7.94e-47 152 46 2 160 3 gpt Xanthine-guanine phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1QK75 1.61e-46 152 45 2 157 3 gpt Xanthine-guanine phosphoribosyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q138L1 1.1e-45 149 44 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain BisB5)
Q5LRI5 1.21e-45 149 44 3 152 3 gpt Xanthine-guanine phosphoribosyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q6N7S7 3.48e-45 148 45 1 155 3 gpt Xanthine-guanine phosphoribosyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2K9D7 8.07e-45 147 46 3 154 3 gpt Xanthine-guanine phosphoribosyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q28PG8 9.41e-45 147 46 4 157 3 gpt Xanthine-guanine phosphoribosyltransferase Jannaschia sp. (strain CCS1)
Q3J3Y6 6.16e-44 145 43 2 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PIG2 6.16e-44 145 43 2 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q5FUI1 6.85e-44 145 48 3 148 3 gpt Xanthine-guanine phosphoribosyltransferase Gluconobacter oxydans (strain 621H)
A4WRD6 1.02e-43 144 43 2 152 3 gpt Xanthine-guanine phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q1GHI7 2.34e-43 144 43 3 157 3 gpt Xanthine-guanine phosphoribosyltransferase Ruegeria sp. (strain TM1040)
Q1MHW9 2.61e-42 140 43 3 154 3 gpt Xanthine-guanine phosphoribosyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q163Y8 2.27e-41 139 43 4 157 3 gpt Xanthine-guanine phosphoribosyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8UEM6 4.73e-41 137 42 3 154 3 gpt Xanthine-guanine phosphoribosyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8YH64 3.16e-38 130 48 3 128 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YQ27 3.16e-38 130 48 3 128 3 gpt Xanthine-guanine phosphoribosyltransferase Brucella abortus (strain 2308)
P18134 5.77e-06 47 28 7 127 3 hpt Hypoxanthine phosphoribosyltransferase Vibrio harveyi
Q8E2H3 2.24e-05 45 36 8 113 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Y1 2.24e-05 45 36 8 113 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q5M6K8 8.77e-05 43 36 7 110 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M216 8.77e-05 43 36 7 110 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain CNRZ 1066)
Q07010 0.000109 43 30 6 145 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Trypanosoma brucei brucei
Q839B2 0.000368 42 26 10 161 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q8DWM8 0.000654 41 31 7 123 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS12255
Feature type CDS
Gene gpt
Product xanthine phosphoribosyltransferase
Location 34945 - 35403 (strand: -1)
Length 459 (nucleotides) / 152 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2025
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00156 Phosphoribosyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2236 Coenzyme transport and metabolism (H) H Hypoxanthine phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00769 xanthine phosphoribosyltransferase [EC:2.4.2.22] Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Nucleotide metabolism		 -

Protein Sequence

MSEKYVVTWDMLQMHARKLAQRLMPVEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCISSYDHDHQREMKVMKKADGDGEGFIIIDDLVDTGGTAQVIRDMYPKAHFVTIFAKPAGQPLVDDYVVDIPQDTWIEQPWDMTVSFVKPICDQ

Flanking regions ( +/- flanking 50bp)

CGCAAAAAAAGACTCTTTTCTGTAAATCATCATGCCGGGATCAAATTGATATGAGCGAAAAATACGTCGTAACGTGGGATATGTTGCAAATGCATGCCCGTAAGCTGGCACAACGTTTAATGCCTGTCGAACAATGGAAAGGCATTATTGCCGTCAGCCGTGGTGGTCTGGTACCGGGTGCCTTACTCGCCCGTGAACTGGGGATCCGCCATGTGGATACTGTCTGCATTTCAAGCTATGATCACGATCATCAGCGCGAAATGAAAGTCATGAAAAAAGCAGACGGTGATGGCGAAGGATTTATCATCATTGATGACCTCGTGGATACCGGCGGTACCGCTCAGGTGATCCGCGATATGTATCCGAAAGCGCATTTTGTCACGATTTTCGCGAAACCAGCCGGTCAGCCGCTGGTTGATGATTACGTGGTGGATATCCCTCAGGATACCTGGATTGAGCAGCCCTGGGATATGACCGTCAGCTTTGTTAAACCAATCTGCGATCAGTAAGCGAATGCCATGACACAACAGAACCTGTCAGAGAAACTTTTTAAGCCTAA