Homologs in group_3286

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08990 FBDBKF_08990 100.0 Morganella morganii S1 fimA Pilin (type 1 fimbrial protein)
EHELCC_10420 EHELCC_10420 100.0 Morganella morganii S2 fimA Pilin (type 1 fimbrial protein)
LHKJJB_10590 LHKJJB_10590 100.0 Morganella morganii S3 fimA Pilin (type 1 fimbrial protein)
HKOGLL_13650 HKOGLL_13650 100.0 Morganella morganii S5 fimA Pilin (type 1 fimbrial protein)

Distribution of the homologs in the orthogroup group_3286

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3286

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P42185 4.33e-17 77 31 6 162 3 prsH PRS fimbrial minor pilin protein Escherichia coli
P07111 6.6e-17 77 31 6 162 1 papH PAP fimbrial minor pilin protein Escherichia coli
Q8X5K5 1.48e-09 57 27 6 176 2 lpfA Probable major fimbrial subunit LpfA Escherichia coli O157:H7
P37909 2.24e-09 57 25 5 177 1 ybgD Uncharacterized fimbrial-like protein YbgD Escherichia coli (strain K12)
P43660 1.41e-08 54 27 7 179 3 lpfA Long polar fimbria protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75855 1.02e-07 52 27 9 187 1 elfA Fimbrial subunit ElfA Escherichia coli (strain K12)
P38052 1.89e-07 51 27 4 144 2 sfmF Uncharacterized fimbrial-like protein SfmF Escherichia coli (strain K12)
Q8X582 1.93e-07 51 26 9 187 1 elfA Laminin-binding fimbrial subunit ElfA Escherichia coli O157:H7
P53521 7.73e-07 50 27 9 188 3 pmfF Putative minor fimbrial subunit PmfF Proteus mirabilis (strain HI4320)
P08189 1.09e-06 49 27 6 151 1 fimF Protein FimF Escherichia coli (strain K12)
P13421 2.54e-06 48 28 6 178 1 smfA Fimbria A protein Serratia marcescens
P37922 1.81e-05 46 27 8 155 3 fimI Fimbrin-like protein FimI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42191 1.92e-05 46 27 6 162 1 prsK Protein PrsK Escherichia coli
Q03011 1.97e-05 46 25 5 170 1 mrpA Major MR/P fimbria protein Proteus mirabilis (strain HI4320)
P62532 2.56e-05 45 27 7 164 1 papK Fimbrial adapter PapK Escherichia coli
P62533 2.56e-05 45 27 7 164 3 papK Fimbrial adapter PapK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P45992 2.78e-05 46 32 5 115 3 hifD Minor fimbrial subunit HifD Haemophilus influenzae
Q08456 3.18e-05 45 27 8 155 5 fimI Putative fimbrin-like protein FimI Salmonella typhi
P21413 6.01e-05 45 28 5 142 3 fasA Fimbrial protein 987P Escherichia coli
P39834 0.000234 43 25 4 164 3 ygiL Uncharacterized fimbrial-like protein YgiL Escherichia coli (strain K12)
P42913 0.00027 43 27 8 195 2 yraH Uncharacterized fimbrial-like protein YraH Escherichia coli (strain K12)
P04127 0.000304 42 24 5 162 1 papA Pap fimbrial major pilin protein Escherichia coli
P42184 0.000799 41 25 4 154 1 prsA PRS fimbrial major pilin protein (Fragment) Escherichia coli

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10765
Feature type CDS
Gene fimA
Product Pilin (type 1 fimbrial protein)
Location 109099 - 109614 (strand: 1)
Length 516 (nucleotides) / 171 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3286
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00419 Fimbrial protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3539 Cell motility (N) N Pilin (type 1 fimbrial protein)

Protein Sequence

MKSNILSTGLLAVCLTAYAAEGERQTGQVWLQGFVLDSSCTINMQDKYQRIEIPQVAATALYQRGYSPAFAFAVRLENCLLSADDKNLRITFTGPSDSNGLFAVSGEAEGVGIQLSREEGSVIIPGKAVALPDIPQTKNITLNYRLRLIADRKSLKTGAYRSTVNFNLDYL

Flanking regions ( +/- flanking 50bp)

TACTTTACCCGTACCGGATATCCGGTACGGGGATCCGGCGGAGAGCAAGCGTGAAGTCAAACATACTCAGTACCGGACTGCTGGCAGTCTGCCTGACTGCTTATGCGGCAGAGGGTGAACGGCAGACCGGGCAGGTCTGGTTACAGGGATTTGTTCTGGACTCCTCCTGCACTATCAATATGCAGGATAAATATCAACGGATTGAAATACCGCAGGTTGCCGCCACCGCATTATATCAGCGCGGATACAGTCCGGCCTTTGCCTTTGCTGTCCGGCTGGAAAACTGTCTGTTGTCAGCGGATGACAAAAATCTGCGGATAACCTTTACCGGACCTTCGGACAGCAACGGATTGTTTGCAGTCAGCGGGGAGGCAGAAGGTGTCGGGATTCAGCTCAGCCGGGAAGAGGGTTCGGTGATCATACCGGGAAAAGCAGTGGCACTCCCGGATATACCACAGACAAAAAATATCACACTGAACTACCGGTTACGGCTGATTGCTGATCGCAAATCACTGAAAACAGGGGCATACCGGTCGACTGTTAACTTCAACCTGGATTATTTGTGATGAATGCCAATGTATTTGCGCCGGGCTGCGGAGTATCACGTCCGGCGGTG