Homologs in group_2798

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09100 FBDBKF_09100 100.0 Morganella morganii S1 - DNA starvation/stationary phase protection protein
EHELCC_10310 EHELCC_10310 100.0 Morganella morganii S2 - DNA starvation/stationary phase protection protein
LHKJJB_10700 LHKJJB_10700 100.0 Morganella morganii S3 - DNA starvation/stationary phase protection protein
HKOGLL_13760 HKOGLL_13760 100.0 Morganella morganii S5 - DNA starvation/stationary phase protection protein
F4V73_RS10850 F4V73_RS10850 78.3 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2798

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2798

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_10655
Feature type CDS
Gene -
Product DNA starvation/stationary phase protection protein
Location 79548 - 79730 (strand: -1)
Length 183 (nucleotides) / 60 (amino acids)

Contig

Accession ZDB_525
Length 191527 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2798
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MAQLTQEEKVYVDDLAMQRVDDMNSDEFLVRQLDDKIHGLASHLKAYFEERLAFHKQNKN

Flanking regions ( +/- flanking 50bp)

TAAAATCGTGATAACATACCATATTCACACTATATTCAGAGAGACAGACAATGGCACAACTGACCCAGGAAGAAAAAGTATATGTTGATGACCTCGCTATGCAGCGGGTTGATGATATGAACAGCGATGAATTTCTGGTTCGTCAGCTGGATGACAAAATCCACGGGCTGGCATCTCACCTGAAAGCCTATTTTGAAGAACGTCTGGCTTTCCATAAACAGAACAAAAACTGATCCTGCCCGGGCAGCCGCAACGCTGCCCGCTGCTTTTTTCCCGCCTGAAA