Homologs in group_2798

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09100 FBDBKF_09100 78.3 Morganella morganii S1 - DNA starvation/stationary phase protection protein
EHELCC_10310 EHELCC_10310 78.3 Morganella morganii S2 - DNA starvation/stationary phase protection protein
NLDBIP_10655 NLDBIP_10655 78.3 Morganella morganii S4 - DNA starvation/stationary phase protection protein
LHKJJB_10700 LHKJJB_10700 78.3 Morganella morganii S3 - DNA starvation/stationary phase protection protein
HKOGLL_13760 HKOGLL_13760 78.3 Morganella morganii S5 - DNA starvation/stationary phase protection protein

Distribution of the homologs in the orthogroup group_2798

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2798

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS10850
Feature type CDS
Gene -
Product hypothetical protein
Location 307268 - 307450 (strand: -1)
Length 183 (nucleotides) / 60 (amino acids)

Contig

Accession term accessions NZ_VXKB01000002 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 573139 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2798
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MTNLTPEEKMYVDNLAMQRMDNMNSDEFLVHQLDEKIHGLAAHLKAYFEERLTFHKQNIG

Flanking regions ( +/- flanking 50bp)

CTCCGGCGAACCAGCTTGCCGGCAGACCTCCGATACAGAGAGACAAAACCATGACAAACCTTACACCCGAAGAAAAAATGTATGTCGATAATCTCGCGATGCAGCGGATGGATAATATGAACAGTGATGAATTTCTGGTGCACCAGCTGGATGAAAAAATTCACGGACTGGCAGCTCATCTCAAAGCCTATTTTGAAGAACGCCTGACTTTCCATAAGCAAAATATCGGCTGACTATCCCCGTGTTTTCTGTCCGGATGGTCAGCAGGACTATCCGGCAGTAT