Homologs in group_1062

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06010 FBDBKF_06010 100.0 Morganella morganii S1 rpsB 30S ribosomal protein S2
EHELCC_09055 EHELCC_09055 100.0 Morganella morganii S2 rpsB 30S ribosomal protein S2
LHKJJB_08320 LHKJJB_08320 100.0 Morganella morganii S3 rpsB 30S ribosomal protein S2
HKOGLL_07870 HKOGLL_07870 100.0 Morganella morganii S5 rpsB 30S ribosomal protein S2
F4V73_RS15885 F4V73_RS15885 94.1 Morganella psychrotolerans rpsB 30S ribosomal protein S2
PMI_RS11285 PMI_RS11285 92.5 Proteus mirabilis HI4320 rpsB 30S ribosomal protein S2

Distribution of the homologs in the orthogroup group_1062

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1062

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8P7 8.94e-172 475 96 0 235 3 rpsB Small ribosomal subunit protein uS2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JQG0 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667I9 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TL92 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pestis (strain Pestoides F)
Q1CFE6 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R396 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZH66 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pestis
B2JZ34 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CAN6 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFG9 3.1e-168 466 93 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q32JU0 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Shigella dysenteriae serotype 1 (strain Sd197)
B7LWA8 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RG21 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain UTI89 / UPEC)
B1LGX0 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain SMS-3-5 / SECEC)
B7N836 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7V0 8.5e-168 465 94 0 235 1 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain K12)
B1IQH2 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7V1 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLG4 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7L3 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O1:K1 / APEC
B1XD38 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain K12 / DH10B)
C4ZRR1 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain K12 / MC4100 / BW2952)
B7MP29 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O81 (strain ED1a)
B7NID0 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0E7 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7V2 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O157:H7
B7MBF0 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIL4 8.5e-168 465 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4F2D3 9.81e-168 465 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Proteus mirabilis (strain HI4320)
A6T4X1 2.52e-167 464 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q3Z5I9 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Shigella sonnei (strain Ss046)
Q325X1 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Shigella boydii serotype 4 (strain Sb227)
B2U311 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6HZE3 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain SE11)
A7ZWB5 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O9:H4 (strain HS)
B7M1A9 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O8 (strain IAI1)
B7LGN0 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli (strain 55989 / EAEC)
A7ZHQ9 3.82e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83SL4 3.91e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Shigella flexneri
Q0T840 3.91e-167 463 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Shigella flexneri serotype 5b (strain 8401)
C6DAI3 8.51e-167 462 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5Y1K2 8.7e-167 462 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Klebsiella pneumoniae (strain 342)
B2VE05 1.16e-166 462 92 0 239 3 rpsB Small ribosomal subunit protein uS2 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NRK7 1.92e-166 461 94 0 235 3 rpsB Small ribosomal subunit protein uS2 Sodalis glossinidius (strain morsitans)
A8ALC1 2.07e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P66541 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66542 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella typhi
B4TXS1 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella schwarzengrund (strain CVM19633)
B5BAM6 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella paratyphi A (strain AKU_12601)
A9N0R7 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD63 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUZ8 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella newport (strain SL254)
B4TK44 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella heidelberg (strain SL476)
B5RHF4 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3I2 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella enteritidis PT4 (strain P125109)
B5FJ16 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella dublin (strain CT_02021853)
A9MPJ3 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8T0 3.01e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella agona (strain SL483)
Q57T39 3.87e-166 461 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Salmonella choleraesuis (strain SC-B67)
A7MGT2 7.55e-166 460 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Cronobacter sakazakii (strain ATCC BAA-894)
A1JP82 2.85e-165 459 91 0 239 3 rpsB Small ribosomal subunit protein uS2 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4W6R4 2.91e-165 459 92 0 235 3 rpsB Small ribosomal subunit protein uS2 Enterobacter sp. (strain 638)
Q6D8E3 4.05e-165 458 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GIE6 1.21e-164 457 93 0 235 3 rpsB Small ribosomal subunit protein uS2 Serratia proteamaculans (strain 568)
Q6LN24 4.82e-156 435 85 0 235 3 rpsB Small ribosomal subunit protein uS2 Photobacterium profundum (strain SS9)
Q87MD8 2.24e-151 424 83 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N1X7 9.01e-151 422 82 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio campbellii (strain ATCC BAA-1116)
Q7MIG0 5.63e-150 420 82 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio vulnificus (strain YJ016)
Q8DBG1 5.63e-150 420 82 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio vulnificus (strain CMCP6)
B5F9X6 6.21e-150 420 83 0 235 3 rpsB Small ribosomal subunit protein uS2 Aliivibrio fischeri (strain MJ11)
Q5E3D9 6.21e-150 420 83 0 235 3 rpsB Small ribosomal subunit protein uS2 Aliivibrio fischeri (strain ATCC 700601 / ES114)
C4L864 4.18e-148 415 82 0 235 3 rpsB Small ribosomal subunit protein uS2 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8CQ85 6.21e-148 415 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella piezotolerans (strain WP3 / JCM 13877)
A0KHG3 6.85e-148 415 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B0TP83 1.48e-147 414 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella halifaxensis (strain HAW-EB4)
C4K5W9 2.09e-147 413 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C3LQ32 2.42e-147 413 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio cholerae serotype O1 (strain M66-2)
Q9KPV2 2.42e-147 413 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F607 2.42e-147 413 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B1KNU3 5.5e-147 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella woodyi (strain ATCC 51908 / MS32)
A1RLM7 6.28e-147 412 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella sp. (strain W3-18-1)
A4Y543 6.28e-147 412 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8FY42 7e-147 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella sediminis (strain HAW-EB3)
A8H6L6 8.17e-147 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A9KUK5 1.01e-146 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella baltica (strain OS195)
A6WLA6 1.01e-146 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella baltica (strain OS185)
A3D2K5 1.01e-146 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E7R6 1.01e-146 412 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella baltica (strain OS223)
Q0HT62 1.67e-146 411 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella sp. (strain MR-7)
Q0HGV5 1.67e-146 411 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella sp. (strain MR-4)
A0KZ23 1.67e-146 411 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella sp. (strain ANA-3)
Q8EGH5 1.67e-146 411 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B6EK57 1.69e-146 411 81 0 235 3 rpsB Small ribosomal subunit protein uS2 Aliivibrio salmonicida (strain LFI1238)
A4SQI2 2.7e-146 410 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Aeromonas salmonicida (strain A449)
B0UTA0 2.73e-146 410 81 0 239 3 rpsB Small ribosomal subunit protein uS2 Histophilus somni (strain 2336)
Q0I458 2.73e-146 410 81 0 239 3 rpsB Small ribosomal subunit protein uS2 Histophilus somni (strain 129Pt)
A1SYW3 5.01e-146 410 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q12NY7 9.84e-146 409 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q085E2 7.9e-145 407 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella frigidimarina (strain NCIMB 400)
A1S4P0 7.9e-145 407 82 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3QGA3 8.53e-145 407 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q15WG3 2.48e-144 405 79 0 235 3 rpsB Small ribosomal subunit protein uS2 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3IIX4 7.64e-143 402 80 0 235 3 rpsB Small ribosomal subunit protein uS2 Pseudoalteromonas translucida (strain TAC 125)
Q485H0 4.56e-142 400 77 0 235 3 rpsB Small ribosomal subunit protein uS2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P57982 4.58e-141 397 82 1 239 3 rpsB Small ribosomal subunit protein uS2 Pasteurella multocida (strain Pm70)
Q65R70 8.51e-141 397 80 1 242 3 rpsB Small ribosomal subunit protein uS2 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8K9T0 1.56e-140 396 81 0 221 3 rpsB Small ribosomal subunit protein uS2 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1LSV7 1.23e-139 393 80 0 228 3 rpsB Small ribosomal subunit protein uS2 Baumannia cicadellinicola subsp. Homalodisca coagulata
P44371 7.66e-139 392 81 1 239 1 rpsB Small ribosomal subunit protein uS2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UI55 7.66e-139 392 81 1 239 3 rpsB Small ribosomal subunit protein uS2 Haemophilus influenzae (strain PittGG)
A5UDG2 7.66e-139 392 81 1 239 3 rpsB Small ribosomal subunit protein uS2 Haemophilus influenzae (strain PittEE)
Q4QLZ6 7.66e-139 392 81 1 239 3 rpsB Small ribosomal subunit protein uS2 Haemophilus influenzae (strain 86-028NP)
B0BUC4 1.38e-137 389 79 0 237 3 rpsB Small ribosomal subunit protein uS2 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXB0 1.38e-137 389 79 0 237 3 rpsB Small ribosomal subunit protein uS2 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q89AP2 3.22e-137 387 80 0 220 3 rpsB Small ribosomal subunit protein uS2 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A3MZT2 8.12e-137 387 79 0 237 3 rpsB Small ribosomal subunit protein uS2 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q7VL79 2.35e-136 385 80 1 234 3 rpsB Small ribosomal subunit protein uS2 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8D7D2 9.19e-135 382 76 0 228 3 rpsB Small ribosomal subunit protein uS2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57325 9.19e-135 382 76 0 228 3 rpsB Small ribosomal subunit protein uS2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D928 9.19e-135 382 76 0 228 3 rpsB Small ribosomal subunit protein uS2 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A6VME7 1.61e-134 381 78 1 241 3 rpsB Small ribosomal subunit protein uS2 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q5QXS0 3.02e-133 378 79 0 226 3 rpsB Small ribosomal subunit protein uS2 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q493D2 2.97e-132 375 78 0 221 3 rpsB Small ribosomal subunit protein uS2 Blochmanniella pennsylvanica (strain BPEN)
B8F3R7 2.28e-131 373 79 0 228 3 rpsB Small ribosomal subunit protein uS2 Glaesserella parasuis serovar 5 (strain SH0165)
Q7VRE6 4.58e-130 369 78 0 221 3 rpsB Small ribosomal subunit protein uS2 Blochmanniella floridana
P34831 2.84e-129 368 73 1 233 3 rpsB Small ribosomal subunit protein uS2 Arthrospira platensis
Q8D2G2 5.15e-128 364 72 0 225 3 rpsB Small ribosomal subunit protein uS2 Wigglesworthia glossinidia brevipalpis
A4VJS1 1.63e-126 361 71 1 239 3 rpsB Small ribosomal subunit protein uS2 Stutzerimonas stutzeri (strain A1501)
Q0VQF7 2.79e-126 360 73 0 225 3 rpsB Small ribosomal subunit protein uS2 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
O82850 5.04e-126 360 70 1 239 1 rpsB Small ribosomal subunit protein uS2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RC8 5.04e-126 360 70 1 239 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7F7 5.04e-126 360 70 1 239 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas aeruginosa (strain LESB58)
A6V1D2 1.66e-125 358 70 1 239 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas aeruginosa (strain PA7)
A4XWU1 8.24e-125 357 73 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas mendocina (strain ymp)
C1DSU6 6.96e-124 354 72 0 225 3 rpsB Small ribosomal subunit protein uS2 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1U3Q4 8.94e-124 354 71 1 236 3 rpsB Small ribosomal subunit protein uS2 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q057T1 2.01e-123 353 73 0 218 3 rpsB Small ribosomal subunit protein uS2 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
A6VUS2 2.1e-123 353 73 0 226 3 rpsB Small ribosomal subunit protein uS2 Marinomonas sp. (strain MWYL1)
Q48F59 7.11e-123 352 72 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q886P3 2.27e-122 350 71 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q21HH2 6.07e-122 349 70 0 231 3 rpsB Small ribosomal subunit protein uS2 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q4KHH6 7.38e-122 349 71 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZWS8 1.08e-121 348 71 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas syringae pv. syringae (strain B728a)
C5BQF6 1.66e-121 348 70 1 237 3 rpsB Small ribosomal subunit protein uS2 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q3KHB2 2.28e-121 348 71 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas fluorescens (strain Pf0-1)
Q1I626 2.63e-121 347 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas entomophila (strain L48)
C3K5E6 3e-121 347 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas fluorescens (strain SBW25)
B1JBR0 6.32e-121 347 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas putida (strain W619)
Q88MI0 7.53e-121 346 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W850 7.53e-121 346 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q2SBP7 2.36e-120 345 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Hahella chejuensis (strain KCTC 2396)
Q6FA53 5.1e-120 344 71 0 223 3 rpsB Small ribosomal subunit protein uS2 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B3PBP6 1.31e-119 343 67 1 246 3 rpsB Small ribosomal subunit protein uS2 Cellvibrio japonicus (strain Ueda107)
B0KS99 1.76e-119 343 70 0 227 3 rpsB Small ribosomal subunit protein uS2 Pseudomonas putida (strain GB-1)
Q31G43 9.09e-119 341 66 1 240 3 rpsB Small ribosomal subunit protein uS2 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8GPS8 1.5e-115 334 70 0 214 3 rpsB Small ribosomal subunit protein uS2 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q1R033 1.8e-115 333 71 0 218 3 rpsB Small ribosomal subunit protein uS2 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1QDT1 1.29e-114 331 68 0 222 3 rpsB Small ribosomal subunit protein uS2 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUT9 1.29e-114 331 68 0 222 3 rpsB Small ribosomal subunit protein uS2 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0A7I0 6.32e-113 327 65 0 226 3 rpsB Small ribosomal subunit protein uS2 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A5WCX2 2.99e-112 325 67 0 222 3 rpsB Small ribosomal subunit protein uS2 Psychrobacter sp. (strain PRwf-1)
Q3JCX5 3.04e-107 313 64 0 226 3 rpsB Small ribosomal subunit protein uS2 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3BVK3 9.34e-107 311 61 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q5NZH5 1.1e-106 311 62 0 227 3 rpsB Small ribosomal subunit protein uS2 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1WX21 1.4e-106 310 63 0 225 3 rpsB Small ribosomal subunit protein uS2 Halorhodospira halophila (strain DSM 244 / SL1)
B0RW65 3.55e-106 310 61 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas campestris pv. campestris (strain B100)
Q4USR2 3.55e-106 310 61 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas campestris pv. campestris (strain 8004)
Q8PMK5 3.87e-106 310 61 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas axonopodis pv. citri (strain 306)
Q8PAV2 1.11e-105 309 61 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B4SQ23 3.1e-105 308 61 1 240 3 rpsB Small ribosomal subunit protein uS2 Stenotrophomonas maltophilia (strain R551-3)
B2FIA9 3.94e-105 307 63 0 226 3 rpsB Small ribosomal subunit protein uS2 Stenotrophomonas maltophilia (strain K279a)
Q1H139 3.05e-104 305 61 0 227 3 rpsB Small ribosomal subunit protein uS2 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A5ICL0 4.4e-104 304 59 0 228 3 rpsB Small ribosomal subunit protein uS2 Legionella pneumophila (strain Corby)
Q5X4J7 4.4e-104 304 59 0 228 3 rpsB Small ribosomal subunit protein uS2 Legionella pneumophila (strain Paris)
B2JIC6 8.07e-104 303 60 0 223 3 rpsB Small ribosomal subunit protein uS2 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5WVY7 3.15e-103 302 58 0 228 3 rpsB Small ribosomal subunit protein uS2 Legionella pneumophila (strain Lens)
Q5ZUS8 3.18e-103 302 58 0 228 3 rpsB Small ribosomal subunit protein uS2 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A1K6S1 8.04e-103 301 60 0 227 3 rpsB Small ribosomal subunit protein uS2 Azoarcus sp. (strain BH72)
Q63T12 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia pseudomallei (strain K96243)
A3NAU8 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia pseudomallei (strain 668)
Q3JR28 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia pseudomallei (strain 1710b)
A3NWN1 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia pseudomallei (strain 1106a)
A1V569 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia mallei (strain SAVP1)
Q62JC4 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia mallei (strain ATCC 23344)
A2SB72 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia mallei (strain NCTC 10229)
A3MKU3 8.44e-103 301 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia mallei (strain NCTC 10247)
Q5H1E0 2.44e-102 300 59 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4A5 2.44e-102 300 59 1 242 3 rpsB Small ribosomal subunit protein uS2 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q13XB6 2.89e-102 300 59 0 223 3 rpsB Small ribosomal subunit protein uS2 Paraburkholderia xenovorans (strain LB400)
B0U5I9 5.07e-102 300 60 1 241 3 rpsB Small ribosomal subunit protein uS2 Xylella fastidiosa (strain M12)
B2T5J4 6.77e-102 298 60 0 223 3 rpsB Small ribosomal subunit protein uS2 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q2L162 9.6e-102 298 62 0 224 3 rpsB Small ribosomal subunit protein uS2 Bordetella avium (strain 197N)
P66547 1.1e-101 298 60 1 241 3 rpsB Small ribosomal subunit protein uS2 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P66546 1.1e-101 298 60 1 241 3 rpsB Small ribosomal subunit protein uS2 Xylella fastidiosa (strain 9a5c)
B2I9U3 1.1e-101 298 60 1 241 3 rpsB Small ribosomal subunit protein uS2 Xylella fastidiosa (strain M23)
Q470D7 1.53e-101 298 59 1 230 3 rpsB Small ribosomal subunit protein uS2 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LNF8 1.64e-101 297 59 1 230 3 rpsB Small ribosomal subunit protein uS2 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q47F92 1.67e-101 298 61 0 225 3 rpsB Small ribosomal subunit protein uS2 Dechloromonas aromatica (strain RCB)
Q82TZ6 1.78e-101 298 61 0 227 3 rpsB Small ribosomal subunit protein uS2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0KA16 2.46e-101 297 58 1 230 3 rpsB Small ribosomal subunit protein uS2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q2SWZ8 2.53e-101 297 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q8XZJ1 3.56e-101 296 59 1 230 3 rpsB Small ribosomal subunit protein uS2 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7VYD0 4.39e-101 296 60 0 232 3 rpsB Small ribosomal subunit protein uS2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WA60 4.39e-101 296 60 0 232 3 rpsB Small ribosomal subunit protein uS2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WJ94 4.39e-101 296 60 0 232 3 rpsB Small ribosomal subunit protein uS2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B3R2B7 5.69e-101 296 58 1 230 3 rpsB Small ribosomal subunit protein uS2 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0AEH4 5.78e-101 296 61 0 225 3 rpsB Small ribosomal subunit protein uS2 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0BE15 9.72e-101 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YS74 9.72e-101 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia ambifaria (strain MC40-6)
B4ECN1 1.87e-100 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q2YBA7 2e-100 295 60 0 225 3 rpsB Small ribosomal subunit protein uS2 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1BHI2 2.14e-100 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia orbicola (strain AU 1054)
B1JUF0 2.14e-100 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia orbicola (strain MC0-3)
Q39F43 2.14e-100 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0K8E3 2.14e-100 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia cenocepacia (strain HI2424)
A4JF75 2.41e-100 295 58 0 223 3 rpsB Small ribosomal subunit protein uS2 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B2UB06 4.6e-100 294 58 1 230 3 rpsB Small ribosomal subunit protein uS2 Ralstonia pickettii (strain 12J)
Q60BB0 6.95e-100 294 55 1 238 3 rpsB Small ribosomal subunit protein uS2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B6ISV1 7.91e-99 291 56 0 238 3 rpsB Small ribosomal subunit protein uS2 Rhodospirillum centenum (strain ATCC 51521 / SW)
A5EV13 1.2e-98 291 56 0 226 3 rpsB Small ribosomal subunit protein uS2 Dichelobacter nodosus (strain VCS1703A)
B0U101 7.78e-98 288 58 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A4IZU6 1.29e-97 287 59 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q4H1 1.29e-97 287 59 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. novicida (strain U112)
Q0BNT9 1.97e-97 287 59 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5I2 1.97e-97 287 59 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. holarctica (strain LVS)
A7N9R4 1.97e-97 287 59 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NHY0 2.4e-97 286 58 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JD2 2.4e-97 286 58 0 229 3 rpsB Small ribosomal subunit protein uS2 Francisella tularensis subsp. tularensis (strain FSC 198)
A4G4S1 4.23e-97 286 58 0 224 3 rpsB Small ribosomal subunit protein uS2 Herminiimonas arsenicoxydans
A6SZQ1 1.64e-96 285 57 0 224 3 rpsB Small ribosomal subunit protein uS2 Janthinobacterium sp. (strain Marseille)
B1XTU3 2.35e-96 285 56 0 227 3 rpsB Small ribosomal subunit protein uS2 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q3A395 2.9e-96 285 56 1 240 3 rpsB Small ribosomal subunit protein uS2 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q0BSM5 3.51e-96 284 55 2 245 3 rpsB Small ribosomal subunit protein uS2 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q7NVZ4 3.83e-96 284 56 1 239 3 rpsB Small ribosomal subunit protein uS2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P49668 4.68e-96 284 56 1 239 3 rpsB Small ribosomal subunit protein uS2 Pediococcus acidilactici
Q1GRQ0 7.71e-96 284 58 1 235 3 rpsB Small ribosomal subunit protein uS2 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A1W918 8.94e-96 283 55 1 237 3 rpsB Small ribosomal subunit protein uS2 Acidovorax sp. (strain JS42)
Q3SKN9 1.01e-95 283 58 1 225 3 rpsB Small ribosomal subunit protein uS2 Thiobacillus denitrificans (strain ATCC 25259)
Q5F5F3 1.45e-95 282 54 1 242 3 rpsB Small ribosomal subunit protein uS2 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q165Z3 1.55e-95 283 56 1 234 3 rpsB Small ribosomal subunit protein uS2 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A4SYV1 1.98e-95 282 56 0 227 3 rpsB Small ribosomal subunit protein uS2 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B9MGL7 4.76e-95 281 54 1 237 3 rpsB Small ribosomal subunit protein uS2 Acidovorax ebreus (strain TPSY)
A1KWH6 6.93e-95 280 55 0 229 3 rpsB Small ribosomal subunit protein uS2 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q03FT6 7.66e-95 281 55 0 239 3 rpsB Small ribosomal subunit protein uS2 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q39W88 1.75e-94 280 57 1 233 3 rpsB Small ribosomal subunit protein uS2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
P66540 4.03e-94 278 55 0 229 1 rpsB Small ribosomal subunit protein uS2 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66539 4.03e-94 278 55 0 229 3 rpsB Small ribosomal subunit protein uS2 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B3E716 5.23e-94 279 57 0 224 3 rpsB Small ribosomal subunit protein uS2 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A8LK91 9.98e-94 278 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q21WY9 1.3e-93 278 58 1 223 3 rpsB Small ribosomal subunit protein uS2 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9BMN2 1.75e-93 277 56 1 227 3 rpsB Small ribosomal subunit protein uS2 Delftia acidovorans (strain DSM 14801 / SPH-1)
A7HY19 1.76e-93 277 56 1 235 3 rpsB Small ribosomal subunit protein uS2 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A9M489 1.88e-93 277 55 0 229 3 rpsB Small ribosomal subunit protein uS2 Neisseria meningitidis serogroup C (strain 053442)
Q1D1H9 2.2e-93 279 56 0 232 3 rpsB Small ribosomal subunit protein uS2 Myxococcus xanthus (strain DK1622)
Q049U2 2.44e-93 277 52 1 247 3 rpsB Small ribosomal subunit protein uS2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9N6 2.44e-93 277 52 1 247 3 rpsB Small ribosomal subunit protein uS2 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B4UMB8 3.21e-93 279 56 0 231 3 rpsB Small ribosomal subunit protein uS2 Anaeromyxobacter sp. (strain K)
Q2IML9 3.21e-93 279 56 0 231 3 rpsB Small ribosomal subunit protein uS2 Anaeromyxobacter dehalogenans (strain 2CP-C)
A5V3G2 7.74e-93 276 57 1 236 3 rpsB Small ribosomal subunit protein uS2 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5FZ67 9.56e-93 276 56 1 238 3 rpsB Small ribosomal subunit protein uS2 Acidiphilium cryptum (strain JF-5)
Q2W4C3 1.25e-92 276 53 1 234 3 rpsB Small ribosomal subunit protein uS2 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5LRZ4 2.17e-92 275 55 1 233 3 rpsB Small ribosomal subunit protein uS2 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
C5CKS0 2.63e-92 274 56 1 224 3 rpsB Small ribosomal subunit protein uS2 Variovorax paradoxus (strain S110)
B1XXJ5 2.93e-92 274 56 1 227 3 rpsB Small ribosomal subunit protein uS2 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q38W64 3.84e-92 274 53 0 239 3 rpsB Small ribosomal subunit protein uS2 Latilactobacillus sakei subsp. sakei (strain 23K)
Q9X5U8 3.9e-92 276 59 1 227 3 rpsB Small ribosomal subunit protein uS2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N8R0 3.9e-92 276 59 1 227 3 rpsB Small ribosomal subunit protein uS2 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBR3 3.9e-92 276 59 1 227 3 rpsB Small ribosomal subunit protein uS2 Coxiella burnetii (strain Dugway 5J108-111)
A1AXW9 4.22e-92 276 56 1 226 3 rpsB Small ribosomal subunit protein uS2 Ruthia magnifica subsp. Calyptogena magnifica
Q74IR7 6.77e-92 274 54 0 226 3 rpsB Small ribosomal subunit protein uS2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q74BW1 6.96e-92 273 56 1 233 3 rpsB Small ribosomal subunit protein uS2 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A8MHG9 7.34e-92 273 55 1 234 3 rpsB Small ribosomal subunit protein uS2 Alkaliphilus oremlandii (strain OhILAs)
Q28PY9 1.12e-91 273 54 0 234 3 rpsB Small ribosomal subunit protein uS2 Jannaschia sp. (strain CCS1)
Q044D0 1.36e-91 273 54 0 226 3 rpsB Small ribosomal subunit protein uS2 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
C6E512 1.53e-91 273 56 0 224 3 rpsB Small ribosomal subunit protein uS2 Geobacter sp. (strain M21)
B2GBL8 1.95e-91 272 52 1 242 3 rpsB Small ribosomal subunit protein uS2 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B5EHW1 2.27e-91 272 56 0 224 3 rpsB Small ribosomal subunit protein uS2 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A8YVR9 2.56e-91 272 55 0 223 3 rpsB Small ribosomal subunit protein uS2 Lactobacillus helveticus (strain DPC 4571)
Q0APW5 2.63e-91 273 58 1 221 3 rpsB Small ribosomal subunit protein uS2 Maricaulis maris (strain MCS10)
A6TRM3 3.28e-91 271 55 0 226 3 rpsB Small ribosomal subunit protein uS2 Alkaliphilus metalliredigens (strain QYMF)
Q9X5E7 3.62e-91 271 55 1 237 3 rpsB Small ribosomal subunit protein uS2 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B9M5C6 4.37e-91 271 55 1 240 3 rpsB Small ribosomal subunit protein uS2 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q2NBU6 7.03e-91 270 60 1 218 3 rpsB Small ribosomal subunit protein uS2 Erythrobacter litoralis (strain HTCC2594)
C5D9B5 8.79e-91 270 54 0 235 3 rpsB Small ribosomal subunit protein uS2 Geobacillus sp. (strain WCH70)
A7H716 1.04e-90 273 54 0 224 3 rpsB Small ribosomal subunit protein uS2 Anaeromyxobacter sp. (strain Fw109-5)
A1WHU2 1.15e-90 270 53 1 237 3 rpsB Small ribosomal subunit protein uS2 Verminephrobacter eiseniae (strain EF01-2)
Q2RU09 1.17e-90 270 52 0 238 3 rpsB Small ribosomal subunit protein uS2 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5L0K2 1.35e-90 269 54 1 235 3 rpsB Small ribosomal subunit protein uS2 Geobacillus kaustophilus (strain HTA426)
Q1GHC3 1.6e-90 270 56 1 234 3 rpsB Small ribosomal subunit protein uS2 Ruegeria sp. (strain TM1040)
Q5WFS8 1.8e-90 269 55 0 224 3 rpsB Small ribosomal subunit protein uS2 Shouchella clausii (strain KSM-K16)
Q88VJ4 1.81e-90 270 54 0 225 3 rpsB Small ribosomal subunit protein uS2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q9KA63 2.61e-90 269 55 0 226 3 rpsB Small ribosomal subunit protein uS2 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5FJM3 3.52e-90 269 54 0 223 3 rpsB Small ribosomal subunit protein uS2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A5G7W8 3.8e-90 269 54 1 235 3 rpsB Small ribosomal subunit protein uS2 Geotalea uraniireducens (strain Rf4)
Q1IU82 4.61e-90 270 54 0 224 3 rpsB Small ribosomal subunit protein uS2 Koribacter versatilis (strain Ellin345)
Q89KP3 6.03e-90 271 54 1 242 3 rpsB Small ribosomal subunit protein uS2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A1TN69 6.92e-90 268 54 1 224 3 rpsB Small ribosomal subunit protein uS2 Paracidovorax citrulli (strain AAC00-1)
Q02AL1 7.95e-90 270 56 1 227 3 rpsB Small ribosomal subunit protein uS2 Solibacter usitatus (strain Ellin6076)
Q2G8L0 1.21e-89 268 57 2 233 3 rpsB Small ribosomal subunit protein uS2 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A1B8E9 1.49e-89 268 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Paracoccus denitrificans (strain Pd 1222)
Q12A31 1.6e-89 267 52 1 237 3 rpsB Small ribosomal subunit protein uS2 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VFA8 1.77e-89 267 57 0 224 3 rpsB Small ribosomal subunit protein uS2 Nitratidesulfovibrio vulgaris (strain DP4)
Q72DQ5 1.77e-89 267 57 0 224 3 rpsB Small ribosomal subunit protein uS2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A9W4G3 1.79e-89 271 57 1 220 3 rpsB Small ribosomal subunit protein uS2 Methylorubrum extorquens (strain PA1)
B7KZG0 1.79e-89 271 57 1 220 3 rpsB Small ribosomal subunit protein uS2 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q5FUV7 1.8e-89 268 56 1 238 3 rpsB Small ribosomal subunit protein uS2 Gluconobacter oxydans (strain 621H)
A4J5Z3 1.93e-89 266 55 0 226 3 rpsB Small ribosomal subunit protein uS2 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A9NHC6 2.01e-89 270 58 0 224 3 rpsB Small ribosomal subunit protein uS2 Acholeplasma laidlawii (strain PG-8A)
Q03WX5 2.26e-89 267 53 1 231 3 rpsB Small ribosomal subunit protein uS2 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
A7GRF7 2.38e-89 266 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A9HRQ9 2.84e-89 267 57 1 238 3 rpsB Small ribosomal subunit protein uS2 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
C1F401 2.98e-89 268 53 0 224 3 rpsB Small ribosomal subunit protein uS2 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q313G2 5.77e-89 266 53 0 234 3 rpsB Small ribosomal subunit protein uS2 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q1WUL5 6.8e-89 266 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Ligilactobacillus salivarius (strain UCC118)
Q038L2 7.34e-89 266 52 2 242 3 rpsB Small ribosomal subunit protein uS2 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WES8 7.34e-89 266 52 2 242 3 rpsB Small ribosomal subunit protein uS2 Lacticaseibacillus casei (strain BL23)
B1YI76 8.23e-89 265 51 1 242 3 rpsB Small ribosomal subunit protein uS2 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B4RBZ4 8.32e-89 267 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Phenylobacterium zucineum (strain HLK1)
A4IMC3 8.75e-89 265 53 1 235 3 rpsB Small ribosomal subunit protein uS2 Geobacillus thermodenitrificans (strain NG80-2)
B2G6U1 9.13e-89 266 52 1 233 3 rpsB Small ribosomal subunit protein uS2 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJC5 9.13e-89 266 52 1 233 3 rpsB Small ribosomal subunit protein uS2 Limosilactobacillus reuteri (strain DSM 20016)
A2RNV0 9.74e-89 265 50 0 226 1 rpsB Small ribosomal subunit protein uS2 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDR4 1.1e-88 265 50 0 226 3 rpsB Small ribosomal subunit protein uS2 Lactococcus lactis subsp. lactis (strain IL1403)
Q07NJ3 1.13e-88 268 57 0 223 3 rpsB Small ribosomal subunit protein uS2 Rhodopseudomonas palustris (strain BisA53)
B1MZ65 1.29e-88 265 53 1 231 3 rpsB Small ribosomal subunit protein uS2 Leuconostoc citreum (strain KM20)
C4XMY2 1.4e-88 265 51 0 232 3 rpsB Small ribosomal subunit protein uS2 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q6HEY8 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q636J9 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain ZK / E33L)
B9IVB6 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain Q1)
B7HLG0 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain AH187)
C1EP51 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain 03BB102)
Q9XBK3 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJA5 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain AH820)
Q81WK8 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus anthracis
A0RHK0 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus thuringiensis (strain Al Hakam)
C3L7A0 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5M9 1.4e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus anthracis (strain A0248)
Q819X9 1.46e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HDV0 1.46e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain B4264)
B7IUI6 1.46e-88 264 53 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus cereus (strain G9842)
A1AQN2 1.72e-88 265 54 1 239 3 rpsB Small ribosomal subunit protein uS2 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B1LTQ8 1.96e-88 268 54 2 242 3 rpsB Small ribosomal subunit protein uS2 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A3PJM7 2.9e-88 264 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B9KSF0 3e-88 264 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J2N4 3e-88 264 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A4WSP0 3.06e-88 264 54 1 234 3 rpsB Small ribosomal subunit protein uS2 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q2RJP3 3.32e-88 263 53 2 239 3 rpsB Small ribosomal subunit protein uS2 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A9VT65 3.99e-88 263 52 0 233 3 rpsB Small ribosomal subunit protein uS2 Bacillus mycoides (strain KBAB4)
A1VN40 4.11e-88 264 52 1 237 3 rpsB Small ribosomal subunit protein uS2 Polaromonas naphthalenivorans (strain CJ2)
Q04U72 4.76e-88 265 54 1 226 3 rpsB Small ribosomal subunit protein uS2 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
A0AJB1 4.89e-88 263 52 0 234 3 rpsB Small ribosomal subunit protein uS2 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92B01 4.89e-88 263 52 0 234 1 rpsB Small ribosomal subunit protein uS2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B8DSA6 5.97e-88 264 55 0 224 3 rpsB Small ribosomal subunit protein uS2 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8Y6M6 6.29e-88 263 52 0 234 1 rpsB Small ribosomal subunit protein uS2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DFR3 6.29e-88 263 52 0 234 3 rpsB Small ribosomal subunit protein uS2 Listeria monocytogenes serotype 4a (strain HCC23)
Q71Z11 6.29e-88 263 52 0 234 3 rpsB Small ribosomal subunit protein uS2 Listeria monocytogenes serotype 4b (strain F2365)
C1KVV4 6.29e-88 263 52 0 234 3 rpsB Small ribosomal subunit protein uS2 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8F140 7.45e-88 265 54 1 226 3 rpsB Small ribosomal subunit protein uS2 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72U14 7.45e-88 265 54 1 226 3 rpsB Small ribosomal subunit protein uS2 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A5D2T5 7.85e-88 262 53 1 237 3 rpsB Small ribosomal subunit protein uS2 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q1MRE3 9.38e-88 264 53 0 226 3 rpsB Small ribosomal subunit protein uS2 Lawsonia intracellularis (strain PHE/MN1-00)
A5EK55 9.98e-88 265 56 0 223 3 rpsB Small ribosomal subunit protein uS2 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B0THD7 1.15e-87 262 54 0 224 3 rpsB Small ribosomal subunit protein uS2 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A4YVG6 1.2e-87 265 56 0 223 3 rpsB Small ribosomal subunit protein uS2 Bradyrhizobium sp. (strain ORS 278)
Q02VX8 1.24e-87 263 49 0 232 3 rpsB Small ribosomal subunit protein uS2 Lactococcus lactis subsp. cremoris (strain SK11)
Q98MB2 1.8e-87 262 56 1 220 3 rpsB Small ribosomal subunit protein uS2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A6Q585 2.03e-87 263 55 0 222 3 rpsB Small ribosomal subunit protein uS2 Nitratiruptor sp. (strain SB155-2)
B2IGT0 2.29e-87 265 55 2 231 3 rpsB Small ribosomal subunit protein uS2 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q8UFM3 3.46e-87 261 52 2 235 3 rpsB Small ribosomal subunit protein uS2 Agrobacterium fabrum (strain C58 / ATCC 33970)
C4L650 4.25e-87 261 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B5ZN83 4.3e-87 261 52 1 234 3 rpsB Small ribosomal subunit protein uS2 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K8Y7 4.3e-87 261 52 1 234 3 rpsB Small ribosomal subunit protein uS2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B8J3M5 4.91e-87 261 53 0 239 3 rpsB Small ribosomal subunit protein uS2 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
A0L8Q5 6.81e-87 261 55 0 224 3 rpsB Small ribosomal subunit protein uS2 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q1MH54 7.67e-87 261 52 1 234 3 rpsB Small ribosomal subunit protein uS2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A3CQW3 7.76e-87 261 50 1 240 3 rpsB Small ribosomal subunit protein uS2 Streptococcus sanguinis (strain SK36)
B0SZ21 7.81e-87 263 54 1 235 3 rpsB Small ribosomal subunit protein uS2 Caulobacter sp. (strain K31)
B9JEX0 8.19e-87 261 52 1 234 3 rpsB Small ribosomal subunit protein uS2 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q8DS11 1.11e-86 260 51 1 240 3 rpsB Small ribosomal subunit protein uS2 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B3PYP2 1.23e-86 260 52 1 234 3 rpsB Small ribosomal subunit protein uS2 Rhizobium etli (strain CIAT 652)
Q3SRH2 1.33e-86 263 56 0 223 3 rpsB Small ribosomal subunit protein uS2 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B6JH66 1.48e-86 263 55 1 237 3 rpsB Small ribosomal subunit protein uS2 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q215E9 1.49e-86 263 56 0 223 3 rpsB Small ribosomal subunit protein uS2 Rhodopseudomonas palustris (strain BisB18)
A5VQT3 1.88e-86 259 54 1 224 3 rpsB Small ribosomal subunit protein uS2 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A7Z4S0 2.05e-86 259 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q6MGY6 2.06e-86 261 53 0 224 3 rpsB Small ribosomal subunit protein uS2 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A4VXV7 2.12e-86 259 52 0 224 3 rpsB Small ribosomal subunit protein uS2 Streptococcus suis (strain 05ZYH33)
Q185S8 2.77e-86 258 53 1 239 3 rpsB Small ribosomal subunit protein uS2 Clostridioides difficile (strain 630)
A0LJ63 2.84e-86 260 52 0 227 3 rpsB Small ribosomal subunit protein uS2 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B8I6D2 2.91e-86 259 54 1 237 3 rpsB Small ribosomal subunit protein uS2 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B8GWS3 3e-86 259 56 1 217 3 rpsB Small ribosomal subunit protein uS2 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A703 3e-86 259 56 1 217 3 rpsB Small ribosomal subunit protein uS2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A7HMF2 3.07e-86 259 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
C6C1T1 3.21e-86 259 53 1 241 3 rpsB Small ribosomal subunit protein uS2 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
P21464 3.61e-86 258 53 0 226 1 rpsB Small ribosomal subunit protein uS2 Bacillus subtilis (strain 168)
Q73K75 3.7e-86 260 51 0 227 3 rpsB Small ribosomal subunit protein uS2 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A4W453 3.86e-86 259 52 0 224 3 rpsB Small ribosomal subunit protein uS2 Streptococcus suis (strain 98HAH33)
B0UCS0 4.31e-86 262 53 2 242 3 rpsB Small ribosomal subunit protein uS2 Methylobacterium sp. (strain 4-46)
Q11IJ8 4.54e-86 259 55 1 220 3 rpsB Small ribosomal subunit protein uS2 Chelativorans sp. (strain BNC1)
A8I460 4.9e-86 261 56 0 224 3 rpsB Small ribosomal subunit protein uS2 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B8IQY6 5.19e-86 262 54 2 242 3 rpsB Small ribosomal subunit protein uS2 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A3DE59 5.53e-86 258 52 1 239 3 rpsB Small ribosomal subunit protein uS2 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A7INR6 5.82e-86 261 56 1 225 3 rpsB Small ribosomal subunit protein uS2 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q8G0D6 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella suis biovar 1 (strain 1330)
B0CGV9 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RJD0 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5H4 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CX7 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella abortus biovar 1 (strain 9-941)
Q2YRJ1 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella abortus (strain 2308)
B2S611 5.97e-86 258 54 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella abortus (strain S19)
Q1QMN7 7.66e-86 261 55 0 227 3 rpsB Small ribosomal subunit protein uS2 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q03QS1 8.46e-86 258 51 0 225 3 rpsB Small ribosomal subunit protein uS2 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B0K1P9 8.91e-86 257 51 1 238 3 rpsB Small ribosomal subunit protein uS2 Thermoanaerobacter sp. (strain X514)
B9DW41 8.94e-86 258 50 1 235 3 rpsB Small ribosomal subunit protein uS2 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B0K9R6 9.93e-86 257 51 0 235 3 rpsB Small ribosomal subunit protein uS2 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C0MEG6 1.11e-85 258 51 0 226 3 rpsB Small ribosomal subunit protein uS2 Streptococcus equi subsp. zooepidemicus (strain H70)
C0MAG7 1.11e-85 258 51 0 226 3 rpsB Small ribosomal subunit protein uS2 Streptococcus equi subsp. equi (strain 4047)
B1I2K0 1.25e-85 257 53 1 239 3 rpsB Small ribosomal subunit protein uS2 Desulforudis audaxviator (strain MP104C)
B9EBD6 1.34e-85 257 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Macrococcus caseolyticus (strain JCSC5402)
Q8CSU2 1.35e-85 258 51 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HPT5 1.35e-85 258 51 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q67PB7 1.37e-85 258 54 0 226 3 rpsB Small ribosomal subunit protein uS2 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B2A380 1.54e-85 256 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q92Q55 1.58e-85 257 52 2 236 3 rpsB Small ribosomal subunit protein uS2 Rhizobium meliloti (strain 1021)
A0RQU8 1.58e-85 257 52 1 239 3 rpsB Small ribosomal subunit protein uS2 Campylobacter fetus subsp. fetus (strain 82-40)
Q5PAF6 1.65e-85 259 52 3 239 3 rpsB Small ribosomal subunit protein uS2 Anaplasma marginale (strain St. Maries)
A8AZP1 1.92e-85 257 49 1 240 3 rpsB Small ribosomal subunit protein uS2 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A6U8K2 2.01e-85 257 52 2 236 3 rpsB Small ribosomal subunit protein uS2 Sinorhizobium medicae (strain WSM419)
Q2GGV4 2.05e-85 258 50 1 230 3 rpsB Small ribosomal subunit protein uS2 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A8ES83 2.41e-85 257 52 1 239 3 rpsB Small ribosomal subunit protein uS2 Aliarcobacter butzleri (strain RM4018)
Q0C1C1 2.47e-85 257 52 0 234 3 rpsB Small ribosomal subunit protein uS2 Hyphomonas neptunium (strain ATCC 15444)
C3MBQ2 2.64e-85 257 52 2 236 3 rpsB Small ribosomal subunit protein uS2 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q8EQV3 2.78e-85 256 54 0 223 3 rpsB Small ribosomal subunit protein uS2 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q3YRV2 3.46e-85 258 50 1 230 3 rpsB Small ribosomal subunit protein uS2 Ehrlichia canis (strain Jake)
B1ZLB5 3.97e-85 259 58 1 220 3 rpsB Small ribosomal subunit protein uS2 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q65JJ9 4.65e-85 256 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q8RA21 4.89e-85 255 51 0 235 3 rpsB Small ribosomal subunit protein uS2 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6X0J1 5.07e-85 256 52 3 237 3 rpsB Small ribosomal subunit protein uS2 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q4L5V8 5.47e-85 256 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus haemolyticus (strain JCSC1435)
Q8YHH6 6.45e-85 256 53 1 220 3 rpsB Small ribosomal subunit protein uS2 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B9DPG8 7.19e-85 256 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus carnosus (strain TM300)
A7GWR7 8.1e-85 256 51 1 235 3 rpsB Small ribosomal subunit protein uS2 Campylobacter curvus (strain 525.92)
Q3B5U0 8.29e-85 255 53 1 237 3 rpsB Small ribosomal subunit protein uS2 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q3AB77 1.1e-84 254 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B0S184 1.2e-84 255 54 0 224 3 rpsB Small ribosomal subunit protein uS2 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
A7ZF28 1.2e-84 255 52 1 233 3 rpsB Small ribosomal subunit protein uS2 Campylobacter concisus (strain 13826)
B3QLF7 1.25e-84 255 54 0 226 3 rpsB Small ribosomal subunit protein uS2 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A7I1L3 1.37e-84 255 54 0 223 3 rpsB Small ribosomal subunit protein uS2 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
P66545 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain MW2)
A8Z3T6 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G9V7 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain MSSA476)
Q6GHH9 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain MRSA252)
P66544 1.67e-84 254 49 1 239 1 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain N315)
P66543 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QGF6 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain Newman)
Q2YXL2 1.67e-84 254 49 1 239 1 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZ25 1.67e-84 254 49 1 239 1 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHI2 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain USA300)
A7X1N3 1.67e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8CW53 1.68e-84 255 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q0AYK4 1.7e-84 254 51 0 226 3 rpsB Small ribosomal subunit protein uS2 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q3AQ25 1.98e-84 254 53 1 237 3 rpsB Small ribosomal subunit protein uS2 Chlorobium chlorochromatii (strain CaD3)
Q5HGH6 2.31e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain COL)
Q8KBK6 2.42e-84 254 54 1 232 3 rpsB Small ribosomal subunit protein uS2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A5ISE0 2.58e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain JH9)
A6U174 2.58e-84 254 49 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus aureus (strain JH1)
A9KNC4 3.46e-84 253 48 1 242 3 rpsB Small ribosomal subunit protein uS2 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q2GKU9 3.51e-84 255 54 2 227 3 rpsB Small ribosomal subunit protein uS2 Anaplasma phagocytophilum (strain HZ)
Q7VH95 4.3e-84 254 52 0 232 3 rpsB Small ribosomal subunit protein uS2 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q49X41 7.84e-84 253 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q831U9 9.04e-84 253 50 2 240 1 rpsB Small ribosomal subunit protein uS2 Enterococcus faecalis (strain ATCC 700802 / V583)
Q24UF7 1.14e-83 252 51 0 226 3 rpsB Small ribosomal subunit protein uS2 Desulfitobacterium hafniense (strain Y51)
B8FRG5 1.14e-83 252 51 0 226 3 rpsB Small ribosomal subunit protein uS2 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C0ZF66 1.56e-83 251 53 0 224 3 rpsB Small ribosomal subunit protein uS2 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A1BHZ5 2.31e-83 251 53 1 237 3 rpsB Small ribosomal subunit protein uS2 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B5YGD9 2.63e-83 252 52 0 226 3 rpsB Small ribosomal subunit protein uS2 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q5HB22 2.99e-83 253 48 1 230 3 rpsB Small ribosomal subunit protein uS2 Ehrlichia ruminantium (strain Welgevonden)
Q5FGZ8 2.99e-83 253 48 1 230 3 rpsB Small ribosomal subunit protein uS2 Ehrlichia ruminantium (strain Gardel)
C0QB17 3.58e-83 252 49 0 232 3 rpsB Small ribosomal subunit protein uS2 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B7GG89 3.82e-83 250 52 0 235 3 rpsB Small ribosomal subunit protein uS2 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q6G5C9 4.26e-83 251 51 2 239 3 rpsB Small ribosomal subunit protein uS2 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A0QVB8 5.03e-83 252 53 0 224 1 rpsB Small ribosomal subunit protein uS2 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B3QV46 5.07e-83 251 54 0 221 3 rpsB Small ribosomal subunit protein uS2 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q2IW80 8.57e-83 253 55 0 227 3 rpsB Small ribosomal subunit protein uS2 Rhodopseudomonas palustris (strain HaA2)
Q03MW7 1.2e-82 250 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A1USD9 1.33e-82 250 52 2 238 3 rpsB Small ribosomal subunit protein uS2 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q136A4 1.68e-82 252 56 0 223 3 rpsB Small ribosomal subunit protein uS2 Rhodopseudomonas palustris (strain BisB5)
B8EKA1 2.15e-82 253 56 1 220 3 rpsB Small ribosomal subunit protein uS2 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B9KCX7 2.87e-82 249 53 0 223 3 rpsB Small ribosomal subunit protein uS2 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q04F88 3.1e-82 249 52 0 225 3 rpsB Small ribosomal subunit protein uS2 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A4SDC1 3.57e-82 249 51 1 237 3 rpsB Small ribosomal subunit protein uS2 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A6LSP0 3.82e-82 248 51 2 238 3 rpsB Small ribosomal subunit protein uS2 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
O33038 4.35e-82 249 53 0 224 3 rpsB Small ribosomal subunit protein uS2 Mycobacterium leprae (strain TN)
Q7MAK0 5.55e-82 249 51 0 223 3 rpsB Small ribosomal subunit protein uS2 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A9ISJ8 6.01e-82 248 51 2 239 3 rpsB Small ribosomal subunit protein uS2 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8RIH7 7.19e-82 248 47 2 242 3 rpsB Small ribosomal subunit protein uS2 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A1T773 7.61e-82 248 52 0 224 3 rpsB Small ribosomal subunit protein uS2 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q5M6G5 1.05e-81 248 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1X5 1.05e-81 248 50 1 239 3 rpsB Small ribosomal subunit protein uS2 Streptococcus thermophilus (strain CNRZ 1066)
P9WH39 1.22e-81 248 53 0 224 1 rpsB Small ribosomal subunit protein uS2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09435
Feature type CDS
Gene rpsB
Product 30S ribosomal protein S2
Location 28652 - 29371 (strand: -1)
Length 720 (nucleotides) / 239 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1062
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00318 Ribosomal protein S2

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0052 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S2

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02967 small subunit ribosomal protein S2 Ribosome -

Protein Sequence

MATVSMRDMLQAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNDALAELNKIASRKGKILFVGTKRAASEAVQEAAISCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLEAQSQDGTFDKLTKKEALMRTRELGKLENSLGGIKDMGGLPDALFVIDAEHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFIIPGNDDAIRAIKLYLGAVATSVREGRSQDLAVQAEELAAE

Flanking regions ( +/- flanking 50bp)

ATGGGATTCGTGGAGGCATAACCCCAACTTATTATTTACAGAGGTTTAAAATGGCTACTGTTTCCATGCGCGATATGCTCCAGGCGGGCGTTCACTTCGGTCACCAGACTCGTTACTGGAACCCGAAAATGAAACCATTCATCTTTGGTGCCCGTAACAAAGTGCATATCATCAACCTGGAAAAAACTGTTCCGATGTTCAACGACGCATTAGCTGAACTGAACAAAATCGCTTCACGCAAAGGTAAAATCCTGTTCGTAGGTACCAAGCGTGCTGCAAGCGAAGCGGTACAGGAAGCTGCAATCAGCTGTGACCAGTTCTTCGTGAACCACCGCTGGTTAGGCGGTATGCTGACTAACTGGAAAACAGTCCGTCAGTCAATCAAACGCCTGAAAGATTTGGAAGCACAGTCTCAGGACGGTACTTTTGACAAACTGACCAAGAAAGAAGCGCTGATGCGTACCCGTGAACTTGGTAAGTTAGAAAATAGCCTGGGCGGTATCAAAGACATGGGCGGTTTACCTGACGCTCTGTTTGTTATCGATGCTGAGCACGAACACATTGCAATCAAAGAAGCAAACAACCTGGGTATCCCTGTATTTGCTATCGTTGATACTAACTCTGATCCGGACGGTGTTGATTTCATCATCCCTGGTAACGACGATGCAATCCGTGCAATCAAGCTGTACCTGGGCGCAGTCGCGACTTCTGTCCGCGAAGGCCGTTCACAGGATCTGGCTGTTCAGGCTGAAGAATTAGCCGCTGAATAATCTGAGTCCGCTCTCTGAGCGCTCTTATTAACCAGGTATTGCTGCAAATG