Homologs in group_1047

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05920 FBDBKF_05920 100.0 Morganella morganii S1 rof Rho-binding antiterminator
EHELCC_08965 EHELCC_08965 100.0 Morganella morganii S2 rof Rho-binding antiterminator
LHKJJB_08410 LHKJJB_08410 100.0 Morganella morganii S3 rof Rho-binding antiterminator
HKOGLL_07960 HKOGLL_07960 100.0 Morganella morganii S5 rof Rho-binding antiterminator
F4V73_RS15975 F4V73_RS15975 90.9 Morganella psychrotolerans rof Rho-binding antiterminator
PMI_RS11190 PMI_RS11190 55.8 Proteus mirabilis HI4320 rof Rho-binding antiterminator

Distribution of the homologs in the orthogroup group_1047

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1047

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFW9 3.68e-35 117 68 0 80 3 rof Protein rof Shigella flexneri
P0AFW8 3.68e-35 117 68 0 80 1 rof Protein rof Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_09345
Feature type CDS
Gene rof
Product Rho-binding antiterminator
Location 8277 - 8543 (strand: 1)
Length 267 (nucleotides) / 88 (amino acids)

Contig

Accession ZDB_524
Length 215957 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1047
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF07073 Modulator of Rho-dependent transcription termination (ROF)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4568 Transcription (K) K Transcriptional antiterminator Rof (Rho-off)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19000 Rho-binding antiterminator - -

Protein Sequence

MSAENEYQPINCDDYDNLELACQHHMVLEVTLQGGDVLTGKATDLVLRKKVEYLVVTIDNELRELRLDSIVSFSHPELGTVVIDHSPS

Flanking regions ( +/- flanking 50bp)

TGAATAACCATCCGCGGATGATACCGCAAGCGAAAGTATGGTGAGGGAATATGTCTGCAGAAAACGAATATCAACCAATTAATTGTGATGACTATGACAACCTCGAACTGGCCTGCCAGCATCATATGGTACTGGAAGTGACCTTACAGGGGGGCGATGTTCTGACAGGAAAAGCGACCGATTTGGTGCTCCGGAAGAAAGTGGAATACCTTGTTGTCACGATTGACAACGAACTGCGGGAGCTTCGTCTGGACTCTATTGTCAGCTTCAGTCATCCCGAACTGGGAACAGTGGTTATTGATCACTCACCGTCCTGAATAACTCTGCAACCCCGTCCGCGGGGTTGTTTTTTTCCTGCATAATCATC