Homologs in group_1971

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14370 FBDBKF_14370 100.0 Morganella morganii S1 yfcZ DUF406 domain-containing protein
EHELCC_07910 EHELCC_07910 100.0 Morganella morganii S2 yfcZ DUF406 domain-containing protein
LHKJJB_06030 LHKJJB_06030 100.0 Morganella morganii S3 yfcZ DUF406 domain-containing protein
HKOGLL_04885 HKOGLL_04885 100.0 Morganella morganii S5 yfcZ DUF406 domain-containing protein
F4V73_RS02535 F4V73_RS02535 86.7 Morganella psychrotolerans - YfcZ/YiiS family protein
PMI_RS08870 PMI_RS08870 66.3 Proteus mirabilis HI4320 - YfcZ/YiiS family protein

Distribution of the homologs in the orthogroup group_1971

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1971

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD33 2.48e-37 124 62 0 91 3 yfcZ UPF0381 protein YfcZ Escherichia coli (strain K12)
P0AD34 2.48e-37 124 62 0 91 3 yfcZ UPF0381 protein YfcZ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P44686 1.83e-24 91 49 0 91 3 HI_0400 UPF0381 protein HI_0400 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P32162 3.96e-19 77 47 1 84 1 yiiS UPF0381 protein YiiS Escherichia coli (strain K12)
P44027 5.02e-19 77 41 0 86 3 HI_0636 UPF0381 protein HI_0636 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_08235
Feature type CDS
Gene yfcZ
Product DUF406 domain-containing protein
Location 41736 - 42032 (strand: 1)
Length 297 (nucleotides) / 98 (amino acids)
In genomic island -

Contig

Accession ZDB_523
Length 257158 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1971
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04175 Protein of unknown function (DUF406)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3691 Function unknown (S) S Uncharacterized conserved protein YfcZ, UPF0381/DUF406 family

Protein Sequence

MADEKKLCSAEETAACCCVDVGTIIDNESCTSSFERVFASKADAEQMMAALTAKANAAASEPCKIHSEYKETADGVLLKADFTFSCQAETLIFELGLR

Flanking regions ( +/- flanking 50bp)

ATGATTCAGTACTAAGACTGCAGGCTATTTTTAACTAACGGGAGACTGAAATGGCTGACGAAAAAAAACTGTGCAGCGCAGAAGAAACCGCAGCATGCTGCTGTGTGGATGTAGGCACTATTATTGATAACGAAAGCTGCACCTCTTCTTTCGAGCGCGTATTTGCATCTAAAGCAGATGCTGAGCAGATGATGGCAGCACTGACTGCCAAAGCAAATGCAGCAGCATCTGAACCATGCAAAATCCACAGCGAATATAAAGAAACGGCTGACGGCGTTCTGCTGAAAGCGGATTTCACTTTTAGCTGCCAGGCTGAAACACTGATCTTTGAACTGGGTCTGCGTTAATTCATCAGAATAATACGCAAACTGAATTCAGGCCTCCGGTGAATGCGGGG