Homologs in group_3603

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19960 FBDBKF_19960 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_07655 EHELCC_07655 100.0 Morganella morganii S2 - hypothetical protein
LHKJJB_06285 LHKJJB_06285 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_19140 HKOGLL_19140 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3603

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3603

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07980
Feature type CDS
Gene -
Product hypothetical protein
Location 4394 - 4486 (strand: 1)
Length 93 (nucleotides) / 30 (amino acids)

Contig

Accession ZDB_523
Length 257158 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3603
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSPMTKSTMVYPIGFFTCMALIIFIVALVI

Flanking regions ( +/- flanking 50bp)

CGGGTTCTTTGTTTGTCAGATACTAAGTAAGGTTTACAGGAGATTCGATCATGTCACCAATGACGAAAAGTACGATGGTATACCCTATTGGTTTCTTCACCTGCATGGCACTCATTATCTTTATTGTTGCGTTAGTGATTTGATAACGGGTAATGAAGAAGAAAGGAAAACCTCCCGCGTGAACGGGAGGTTT