Homologs in group_3602

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19960 FBDBKF_19960 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_07655 EHELCC_07655 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_07980 NLDBIP_07980 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_06285 LHKJJB_06285 100.0 Morganella morganii S3 - hypothetical protein

Distribution of the homologs in the orthogroup group_3602

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3602

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_19140
Feature type CDS
Gene -
Product hypothetical protein
Location 10942 - 11034 (strand: -1)
Length 93 (nucleotides) / 30 (amino acids)
In genomic island -

Contig

Accession ZDB_711
Length 15427 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3602
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSPMTKSTMVYPIGFFTCMALIIFIVALVI

Flanking regions ( +/- flanking 50bp)

CGGGTTCTTTGTTTGTCAGATACTAAGTAAGGTTTACAGGAGATTCGATCATGTCACCAATGACGAAAAGTACGATGGTATACCCTATTGGTTTCTTCACCTGCATGGCACTCATTATCTTTATTGTTGCGTTAGTGATTTGATAACGGGTAATGAAGAAGAAAGGAAAACCTCCCGCGTGAACGGGAGGTTT