Homologs in group_760

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03420 FBDBKF_03420 100.0 Morganella morganii S1 kdpE two-component system response regulator KdpE
EHELCC_07115 EHELCC_07115 100.0 Morganella morganii S2 kdpE two-component system response regulator KdpE
LHKJJB_06975 LHKJJB_06975 100.0 Morganella morganii S3 kdpE two-component system response regulator KdpE
HKOGLL_03955 HKOGLL_03955 100.0 Morganella morganii S5 kdpE two-component system response regulator KdpE
F4V73_RS11480 F4V73_RS11480 91.6 Morganella psychrotolerans kdpE two-component system response regulator KdpE
PMI_RS05915 PMI_RS05915 63.6 Proteus mirabilis HI4320 kdpE two-component system response regulator KdpE

Distribution of the homologs in the orthogroup group_760

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_760

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P21866 2.34e-126 359 74 0 224 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P9WGN1 2.29e-69 214 50 1 224 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 2.29e-69 214 50 1 224 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q2FWH6 1.05e-51 170 40 1 224 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q8DPL7 8.07e-47 157 37 2 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 8.07e-47 157 37 2 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 8.07e-47 157 37 2 229 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P9WGL9 3.03e-46 155 40 1 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 3.03e-46 155 40 1 225 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 3.03e-46 155 40 1 225 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P32040 1.07e-45 155 38 3 230 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q1B3X8 1.18e-45 154 38 3 226 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 1.18e-45 154 38 3 226 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 1.18e-45 154 38 3 226 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
A0R3I8 1.75e-45 154 37 3 226 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P48259 5.95e-45 153 37 2 227 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
Q742C1 1.98e-44 151 37 3 226 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 1.98e-44 151 37 3 226 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
P28257 2.12e-44 152 37 2 230 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
A1KHB7 2.63e-44 151 37 3 226 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 2.63e-44 151 37 3 226 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P28835 4.27e-44 150 37 2 227 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P9WGM9 4.97e-44 150 37 3 226 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 4.97e-44 150 37 3 226 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 4.97e-44 150 37 3 226 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
O78428 8.37e-44 150 37 2 230 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q9F868 9.08e-44 149 39 1 226 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A0PWB4 3.87e-43 148 37 4 228 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
Q4A160 5.5e-43 147 36 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1TEL7 7.84e-43 147 36 3 227 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
P0C001 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 1.42e-42 146 35 2 221 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 1.42e-42 146 35 2 221 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q9CD68 4.71e-42 145 37 4 227 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P13792 7.38e-42 145 37 4 229 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
P51358 1.14e-41 144 36 2 230 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q9TLQ4 1.81e-41 144 34 2 229 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
Q1XDC9 1.85e-41 144 36 2 230 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
Q8CQK0 6.88e-41 142 35 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 6.88e-41 142 35 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4LAJ9 8.09e-41 142 35 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q99U73 9.44e-41 141 35 3 223 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q7A216 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 1.12e-40 142 34 2 223 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 1.12e-40 142 34 2 223 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 1.12e-40 142 34 2 223 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 1.12e-40 142 34 2 223 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
P54884 1.44e-40 140 41 1 191 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q4L6C6 4.09e-40 140 35 4 222 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P39663 5.16e-40 140 35 5 239 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O34903 1.9e-39 138 38 4 221 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q55890 2.94e-39 138 37 2 227 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q31S42 5.17e-39 138 36 2 224 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P45606 1.31e-38 136 35 4 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
P0AFJ5 1.4e-38 136 35 4 226 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 1.4e-38 136 35 4 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
Q50136 1.58e-38 136 39 3 196 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
Q83RR0 1.7e-38 135 35 4 222 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 1.7e-38 135 35 4 222 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42244 1.88e-38 135 33 1 223 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
P23836 1.93e-38 135 35 4 222 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q8X738 3.57e-38 135 35 4 222 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
P37478 3.93e-38 135 34 2 223 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
P54443 4.87e-38 135 37 4 225 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
P9WGM1 8.43e-38 134 39 3 196 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 8.43e-38 134 39 3 196 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 8.43e-38 134 39 3 196 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45607 2.01e-37 133 34 4 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
Q8Z7H2 2.03e-37 133 35 4 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
P0DM78 4.03e-37 132 35 4 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 4.03e-37 132 35 4 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 4.03e-37 132 35 4 225 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 4.03e-37 132 35 4 225 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 4.03e-37 132 35 4 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P45605 7.15e-37 132 34 3 223 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
Q5HPC3 1.91e-36 130 34 3 222 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
L7N689 2.16e-36 131 35 3 220 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q57QC3 2.2e-36 130 34 4 225 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q06239 2.33e-36 130 31 2 225 3 vanR Regulatory protein VanR Enterococcus faecium
Q8CP82 2.44e-36 130 34 3 222 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9KM23 2.69e-36 130 36 4 224 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45189 4.43e-36 130 33 5 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q49XM7 7.11e-36 129 33 3 221 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P94504 1.12e-35 129 31 3 229 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P23620 1.23e-35 129 33 3 226 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZEP4 1.24e-35 129 36 2 233 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P35163 1.55e-35 129 31 2 229 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
Q82EB1 2.56e-35 128 35 3 234 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q7A0U4 4.34e-35 127 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 4.34e-35 127 33 3 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 4.34e-35 127 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 4.34e-35 127 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 4.34e-35 127 33 3 227 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 4.34e-35 127 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 4.34e-35 127 33 3 227 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 4.34e-35 127 33 3 227 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q9HV32 6.88e-35 126 40 7 224 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P30843 7.21e-35 126 36 5 225 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
P0DMK7 2.12e-33 123 35 2 218 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 2.12e-33 123 35 2 218 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
Q04942 4.19e-33 122 34 1 223 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q44929 8.19e-33 122 32 3 232 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
A0QTK2 9.06e-33 121 33 1 219 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P94413 1.19e-32 120 33 6 227 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q52990 1.26e-32 120 34 5 231 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
Q8CQ37 1.87e-32 120 31 3 228 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.87e-32 120 31 3 228 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8Z181 7.74e-32 119 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 7.74e-32 119 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 7.74e-32 119 29 2 219 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 7.74e-32 119 29 2 219 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 7.74e-32 119 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q7A1L2 9.38e-32 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 9.38e-32 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 9.38e-32 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 9.38e-32 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 9.38e-32 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 9.38e-32 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9HUI2 9.99e-32 119 34 5 233 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q932F1 1.03e-31 118 29 2 219 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q2YSS2 1.35e-31 118 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L481 1.62e-31 118 31 3 228 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q44006 1.64e-31 118 33 2 218 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P9WGM7 1.86e-31 117 32 1 219 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 1.86e-31 117 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 1.86e-31 117 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q93CB8 1.88e-31 117 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q6GJ11 2.25e-31 117 29 2 219 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
P0A9Q4 2.85e-31 117 33 3 228 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 2.85e-31 117 33 3 228 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 2.85e-31 117 33 3 228 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 2.85e-31 117 33 3 228 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
Q9CCJ2 4.02e-31 117 32 1 219 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
P44918 4.34e-31 117 33 4 232 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O69730 5.58e-31 117 32 4 222 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q47456 1.63e-30 115 35 5 224 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
Q70FH0 2.01e-30 115 38 3 175 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
A0A4P7TS68 3.64e-30 115 33 6 230 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 3.64e-30 115 33 6 230 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 3.64e-30 115 33 6 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 3.64e-30 115 33 6 230 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 3.64e-30 115 33 6 230 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 3.64e-30 115 33 6 230 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 3.64e-30 115 33 6 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 3.64e-30 115 33 6 230 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
Q01473 3.82e-30 120 35 4 220 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 9.62e-07 52 31 2 118 3 rcaC Protein RcaC Microchaete diplosiphon
P36556 3.9e-30 114 35 3 179 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9I4F9 4.62e-30 114 35 4 204 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0ACZ8 9.4e-30 113 33 3 219 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 9.4e-30 113 33 3 219 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 9.4e-30 113 33 3 219 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P69228 9.61e-30 114 32 0 220 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 9.61e-30 114 32 0 220 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7A1J1 1.52e-29 113 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 1.52e-29 113 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 1.52e-29 113 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 1.52e-29 113 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 1.52e-29 113 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 1.52e-29 113 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 1.52e-29 113 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 1.52e-29 113 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 1.52e-29 113 30 4 226 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 1.52e-29 113 30 4 226 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
Q8CQ17 2.01e-29 112 30 3 226 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 2.01e-29 112 30 3 226 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7D9K0 2.64e-29 113 36 4 223 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 2.64e-29 113 36 4 223 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q8FZ93 2.94e-29 112 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 2.94e-29 112 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 2.94e-29 112 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 2.94e-29 112 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 2.94e-29 112 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 2.94e-29 112 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 2.94e-29 112 31 2 219 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 2.94e-29 112 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P0A4H8 3.31e-29 112 29 5 224 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 3.31e-29 112 29 5 224 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A6WZ81 4.27e-29 112 31 2 219 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
P42421 4.66e-29 111 30 1 206 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
P31079 7.34e-29 111 31 3 224 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P08368 1e-28 110 34 4 225 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
P0A4I0 1.03e-28 110 31 3 219 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 1.03e-28 110 31 3 219 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
B8H358 1.19e-28 110 31 2 219 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.19e-28 110 31 2 219 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q02540 1.33e-28 110 35 4 184 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
P52076 2.06e-28 109 36 6 222 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P76340 2.08e-28 110 30 2 223 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q49VK3 2.66e-28 109 28 2 219 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8XBS3 4.66e-28 108 36 6 222 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q9I0I1 1.21e-27 107 33 3 224 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O24973 1.37e-27 107 34 2 226 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
Q9AE24 2.81e-27 107 29 3 224 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
O06978 1e-26 105 29 2 228 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
P0A4I2 3.21e-26 103 33 3 221 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 3.21e-26 103 33 3 221 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P13359 6.74e-26 103 32 3 227 3 virG Regulatory protein VirG Rhizobium rhizogenes
A0A0H3GGB5 8.26e-26 103 30 2 231 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
O34951 1.18e-25 102 30 3 223 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
P0AE90 1.88e-25 102 31 3 231 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 1.88e-25 102 31 3 231 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 1.88e-25 102 31 3 231 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P44895 8.94e-25 100 30 2 202 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9K621 1.18e-24 100 27 2 222 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P45337 1.54e-24 99 31 3 219 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
G3XCY6 1.73e-24 100 31 6 227 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5HLN2 1.75e-24 99 27 2 222 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8DN02 2.01e-24 99 30 3 222 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 2.01e-24 99 30 3 222 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q8CN92 2.38e-24 99 27 2 222 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9ZHD3 1.46e-23 97 32 7 233 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P58357 1.86e-23 97 29 6 219 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
Q4L8L9 1.9e-23 97 26 2 225 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
P0CL17 2.22e-23 96 34 4 175 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 2.22e-23 96 34 4 175 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
Q47744 2.7e-23 96 31 6 232 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
P66795 2.85e-23 96 32 6 222 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 2.85e-23 96 32 6 222 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
Q8GP20 2.88e-23 96 29 4 223 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q49ZT8 3.6e-23 96 26 3 223 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O32192 7.14e-23 95 31 8 232 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
P07545 8.54e-23 95 33 3 224 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q07783 2.05e-22 94 27 1 238 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
P38684 2.65e-22 94 27 5 218 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P62722 3.17e-22 94 31 5 226 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
Q6GE73 6.47e-22 92 25 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
Q07597 1.57e-21 92 26 2 225 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q2YZ24 1.86e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A039 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 2.35e-21 91 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q04803 3.79e-21 92 31 2 226 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6QJK3 4.99e-21 90 24 1 204 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 4.99e-21 90 24 1 204 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
P50350 6.83e-21 90 27 2 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q55933 1.56e-20 89 28 5 235 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q44444 2.31e-20 89 33 3 169 3 virG Regulatory protein VirG Rhizobium radiobacter
P33112 2.55e-20 88 27 3 223 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
P39901 3.22e-20 84 72 0 48 5 ybfI Putative uncharacterized protein YbfI Escherichia coli (strain K12)
P55701 5e-20 88 31 3 176 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P50351 2.9e-19 86 27 1 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P52108 5.98e-16 77 27 5 236 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
O31432 2.41e-14 72 27 8 231 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
O25918 9.84e-14 70 25 7 222 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
Q8KIY1 4.75e-13 71 36 2 116 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
T2KMF4 2.06e-12 69 32 2 118 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
P72781 3.78e-12 66 31 7 168 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q05943 6.74e-12 66 34 2 135 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P40138 1.05e-11 66 32 2 125 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
P46384 1.89e-11 62 31 1 113 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
E0X9C7 6.18e-11 65 33 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
B8GZM2 7.24e-11 64 33 1 117 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 7.24e-11 64 33 1 117 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A5W4E3 8.59e-11 64 33 2 116 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q06065 1.21e-10 63 33 1 107 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P48359 1.89e-10 61 27 1 123 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
Q1D359 2.7e-10 62 39 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Myxococcus xanthus (strain DK1622)
P43501 3.56e-10 58 31 1 106 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P24072 4.32e-10 58 32 2 102 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q54SP4 4.5e-10 62 32 2 116 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 3.4e-05 48 28 1 100 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q10WZ6 1.32e-09 60 26 8 204 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
P28787 1.7e-09 60 29 4 121 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
B0R4K1 2.17e-09 57 35 3 105 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q2ILG8 2.51e-09 59 38 2 101 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
P0AFB8 3.02e-09 59 28 2 125 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 3.02e-09 59 28 2 125 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P52942 3.11e-09 56 33 3 112 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q00934 4.41e-09 59 37 6 130 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q93P00 4.46e-09 56 31 2 118 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P51586 4.84e-09 56 32 1 108 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
P09432 5.65e-09 58 34 1 110 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P41789 6.21e-09 58 27 2 125 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q15RF6 9.27e-09 58 32 4 131 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
O25153 1.09e-08 58 27 2 106 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q30RX5 1.17e-08 57 33 4 118 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P0AE69 1.22e-08 55 31 2 118 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 1.22e-08 55 31 2 118 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 1.22e-08 55 31 2 118 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q24T61 1.46e-08 57 33 3 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfitobacterium hafniense (strain Y51)
Q8D0P1 1.75e-08 54 29 2 118 3 cheY Chemotaxis protein CheY Yersinia pestis
Q9F8D7 1.82e-08 57 31 1 111 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
P9WGM3 1.83e-08 56 36 3 118 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 1.83e-08 56 36 3 118 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8DVB7 2.04e-08 56 30 2 114 3 lytR Sensory transduction protein LytR Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q12YX1 2.04e-08 57 27 3 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q8FGP6 2.06e-08 54 31 2 118 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A2D5 2.68e-08 54 30 2 118 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 2.68e-08 54 30 2 118 3 cheY Chemotaxis protein CheY Salmonella typhi
Q9FAD7 2.99e-08 53 33 2 112 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q0A9Z5 3.44e-08 56 32 4 122 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9APD9 3.74e-08 56 29 2 133 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
Q3J1W3 4.01e-08 56 35 3 111 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q8KLS5 4.98e-08 55 35 3 111 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Cereibacter sphaeroides
P52940 5.2e-08 55 34 2 116 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P03029 6.23e-08 55 26 2 126 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q39T95 6.33e-08 55 34 1 101 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q54YZ9 7.37e-08 55 28 1 114 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
Q39QJ2 7.73e-08 55 35 3 102 3 cheB5 Protein-glutamate methylesterase/protein-glutamine glutaminase 5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
O29221 8.27e-08 55 30 2 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q3IDZ3 9.09e-08 55 35 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudoalteromonas translucida (strain TAC 125)
P0C5S3 9.47e-08 53 30 1 111 3 actR Acid tolerance regulatory protein ActR Rhizobium meliloti (strain 1021)
O33558 1.11e-07 55 32 3 112 1 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Cereibacter sphaeroides
Q3ADA6 1.12e-07 55 32 3 112 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
O82868 1.21e-07 53 30 1 111 3 regA Photosynthetic apparatus regulatory protein RegA Rhodovulum sulfidophilum
Q8RAZ3 1.23e-07 54 32 3 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q4UU85 1.37e-07 54 28 2 127 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q9K998 1.4e-07 53 30 3 113 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KQD8 1.62e-07 54 33 3 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A6UEL7 1.69e-07 53 30 1 111 3 actR Acid tolerance regulatory protein ActR Sinorhizobium medicae (strain WSM419)
Q87MK5 1.87e-07 54 32 5 134 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q3J653 1.92e-07 54 32 3 112 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2SFK0 1.94e-07 54 34 2 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q88EW5 2.09e-07 54 34 3 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 1 operon Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0AWZ8 2.25e-07 53 34 3 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P94514 2.25e-07 53 28 2 115 3 lytT Sensory transduction protein LytT Bacillus subtilis (strain 168)
O52262 2.33e-07 53 34 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pseudomonas putida
Q8X613 2.38e-07 53 30 1 110 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P96602 2.4e-07 53 33 3 127 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P06628 2.61e-07 51 28 3 112 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
Q6LTM2 2.82e-07 53 31 6 159 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Photobacterium profundum (strain SS9)
P24908 2.83e-07 52 32 2 109 1 PA0034 Putative transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P62638 3.14e-07 53 35 2 102 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q8EEQ0 3.38e-07 53 35 4 121 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q4KG36 3.64e-07 53 34 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A1SMR4 3.77e-07 53 35 4 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q3KFZ6 4.03e-07 53 34 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas fluorescens (strain Pf0-1)
P62640 4.18e-07 53 36 3 107 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q7MIQ5 4.37e-07 53 31 6 146 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain YJ016)
Q8DB67 4.49e-07 53 31 6 146 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Vibrio vulnificus (strain CMCP6)
P48027 6.03e-07 53 27 2 136 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
Q04849 6.28e-07 52 32 2 108 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q1IQS9 7.14e-07 52 32 3 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Koribacter versatilis (strain Ellin345)
Q4ZQV7 7.26e-07 52 34 2 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Pseudomonas syringae pv. syringae (strain B728a)
Q89SQ1 7.34e-07 52 33 3 105 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q884V3 8.39e-07 52 34 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8E217 8.49e-07 52 29 2 104 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7H3 8.49e-07 52 29 2 104 3 lytR Sensory transduction protein LytR Streptococcus agalactiae serotype III (strain NEM316)
O87125 8.83e-07 52 34 3 104 1 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P14375 9.08e-07 52 30 1 110 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q48GG6 9.17e-07 52 34 2 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5JF95 9.65e-07 52 33 3 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P58253 9.73e-07 52 27 3 143 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P52936 1.12e-06 51 34 3 116 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
O83639 1.13e-06 52 28 5 121 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema pallidum (strain Nichols)
P0DMI2 1.59e-06 51 31 2 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.59e-06 51 31 2 108 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
P10577 1.72e-06 51 34 4 111 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
Q9KA55 1.77e-06 51 28 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P62646 1.89e-06 51 30 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q56312 1.96e-06 48 30 2 102 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q55169 1.97e-06 49 29 3 118 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2FMT2 2.3e-06 50 32 5 125 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q5E3S1 2.58e-06 50 29 4 128 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Aliivibrio fischeri (strain ATCC 700601 / ES114)
P0AEV3 2.64e-06 50 32 1 100 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 2.64e-06 50 32 1 100 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 2.64e-06 50 32 1 100 3 rssB Regulator of RpoS Escherichia coli O157:H7
Q9I6V9 2.7e-06 50 31 5 117 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q53228 3.37e-06 49 28 1 107 1 regA Photosynthetic apparatus regulatory protein RegA Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2SBX9 3.46e-06 50 36 3 104 3 cheB4 Protein-glutamate methylesterase/protein-glutamine glutaminase 4 Hahella chejuensis (strain KCTC 2396)
Q3ADG9 3.55e-06 50 33 4 127 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q8FUS8 3.62e-06 49 28 4 156 3 ftcR Flagellar transcriptional regulator FtcR Brucella suis biovar 1 (strain 1330)
Q8YDL7 3.62e-06 49 28 4 156 1 ftcR Flagellar transcriptional regulator FtcR Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q576I4 3.62e-06 49 28 4 156 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus biovar 1 (strain 9-941)
Q2YJF8 3.62e-06 49 28 4 156 3 ftcR Flagellar transcriptional regulator FtcR Brucella abortus (strain 2308)
Q9ZM64 3.93e-06 48 27 5 122 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P62645 3.94e-06 50 33 3 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P71403 4.34e-06 48 27 5 122 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q82Z76 4.49e-06 49 30 2 102 4 lytT Sensory transduction protein LytT Enterococcus faecalis (strain ATCC 700802 / V583)
P25852 5.13e-06 50 29 1 110 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z333 5.23e-06 50 29 1 110 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q0HWY6 5.34e-06 50 29 3 128 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-7)
Q20XE6 5.46e-06 50 31 3 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodopseudomonas palustris (strain BisB18)
Q9I4N3 5.58e-06 50 32 6 134 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q0HKN5 6.59e-06 49 29 3 128 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella sp. (strain MR-4)
P62647 7.02e-06 49 28 2 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
P39048 7.04e-06 49 24 2 118 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q67P67 7.39e-06 49 33 2 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q48ND9 7.84e-06 49 29 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P0AEL8 8.62e-06 48 32 2 103 3 fimZ Fimbriae Z protein Escherichia coli (strain K12)
P0AEL9 8.62e-06 48 32 2 103 3 fimZ Fimbriae Z protein Escherichia coli O157:H7
Q888V8 8.92e-06 49 30 3 104 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZYD3 9.17e-06 49 29 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Pseudomonas syringae pv. syringae (strain B728a)
Q13SY2 9.23e-06 49 32 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Paraburkholderia xenovorans (strain LB400)
P39486 9.45e-06 48 31 4 115 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
P96686 9.45e-06 48 25 1 103 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
Q7NZB3 1.02e-05 48 30 3 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8TLG9 1.08e-05 48 32 3 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P62637 1.16e-05 48 33 3 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q7CQM5 1.18e-05 48 32 2 82 1 ssrB Response regulator SsrB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52941 1.19e-05 48 33 1 80 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q3IRR4 1.22e-05 48 32 2 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / JCM 8858 / NBRC 14720 / NCIMB 2260 / Gabara)
Q7N5T1 1.36e-05 48 31 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8EQW0 1.51e-05 48 30 3 113 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q31HL9 1.54e-05 48 31 3 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P0A4H5 1.54e-05 46 29 2 105 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 1.54e-05 46 29 2 105 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q085K9 1.89e-05 48 29 4 128 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
Q12PJ3 1.92e-05 48 31 4 128 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P45709 2.1e-05 45 28 3 111 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q81JL3 2.14e-05 47 30 3 105 3 lytT Sensory transduction protein LytT Bacillus anthracis
Q2LR65 2.16e-05 48 34 4 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
Q1XDE4 2.43e-05 47 24 1 118 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
Q8ECD7 2.48e-05 48 28 3 128 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A5VW00 2.49e-05 47 28 4 156 3 ftcR Flagellar transcriptional regulator FtcR Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q88AQ2 2.65e-05 48 28 1 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q2LSL3 2.69e-05 47 26 4 132 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Syntrophus aciditrophicus (strain SB)
Q47GX7 2.87e-05 47 31 3 103 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Dechloromonas aromatica (strain RCB)
Q5QZQ3 3.09e-05 47 29 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7NV40 3.11e-05 47 30 2 104 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
O07528 3.17e-05 47 32 2 101 3 yhcZ Uncharacterized transcriptional regulatory protein YhcZ Bacillus subtilis (strain 168)
P42508 3.19e-05 46 26 1 107 3 regA Photosynthetic apparatus regulatory protein RegA Rhodobacter capsulatus
P45671 3.39e-05 47 30 4 110 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
Q88RJ6 3.52e-05 47 28 1 107 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q56128 3.61e-05 47 27 1 116 3 rcsC Sensor histidine kinase RcsC Salmonella typhi
Q9WY30 3.9e-05 47 28 2 117 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2INL1 4.14e-05 47 35 0 64 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Anaeromyxobacter dehalogenans (strain 2CP-C)
O49397 4.15e-05 47 30 1 108 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q8Q009 4.17e-05 47 30 3 111 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q2RRX2 4.17e-05 47 30 2 112 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q1GZZ0 4.43e-05 47 32 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5A4X5 4.78e-05 47 25 2 127 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q04848 4.81e-05 47 28 1 107 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q940D0 4.86e-05 47 27 2 119 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
Q2W2W9 5.24e-05 47 29 2 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q820K0 5.41e-05 47 31 4 106 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q39WQ9 5.81e-05 47 32 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q4UL27 5.92e-05 47 28 3 119 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9KQD5 6.03e-05 45 26 2 119 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 6.03e-05 45 26 2 119 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P9WMF9 6.12e-05 46 26 4 152 1 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMF8 6.12e-05 46 26 4 152 2 devR DNA-binding transcriptional activator DevR/DosR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1W0A5 6.33e-05 44 25 5 116 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 6.33e-05 44 25 5 116 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 6.33e-05 44 25 5 116 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
P58662 6.43e-05 47 27 1 116 3 rcsC Sensor histidine kinase RcsC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O14283 6.89e-05 47 27 1 101 1 prr1 Transcription factor prr1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q1RJS1 7.06e-05 46 29 3 119 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
Q68WH4 7.11e-05 46 27 3 119 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4L8V4 7.32e-05 46 26 4 130 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
Q814J1 7.47e-05 46 29 3 105 4 lytT Sensory transduction protein LytT Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8CQE3 7.5e-05 46 26 3 135 3 SE_0165 Uncharacterized response regulatory protein SE_0165 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q75KW7 8.41e-05 44 31 3 122 3 RR41 Two-component response regulator ORR41 Oryza sativa subsp. japonica
Q2YV67 8.59e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q5V0B3 8.71e-05 46 35 1 79 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
P60610 9.17e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 9.17e-05 45 30 3 104 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 9.17e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 9.17e-05 45 30 3 104 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 9.17e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q7MBQ5 9.38e-05 46 30 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q6GK51 9.61e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
O87717 9.63e-05 46 27 5 131 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q12IZ9 9.85e-05 46 28 3 102 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8NYH3 9.89e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 9.89e-05 45 30 3 104 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
Q8D4X6 9.9e-05 46 30 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
Q1BRL2 0.000103 46 31 4 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
P18769 0.000106 46 35 1 77 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q5HKE0 0.000106 45 26 3 136 3 SERP2406 Uncharacterized response regulatory protein SERP2406 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q3SIG0 0.000108 45 30 3 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q2FQU2 0.000112 45 25 2 112 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q9KU36 0.000112 45 28 3 125 3 VC_0693 Uncharacterized response regulatory protein VC_0693 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0HVI0 0.000113 45 32 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-7)
P52929 0.000113 45 30 1 82 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q9ZCY9 0.000115 46 27 3 119 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q51455 0.000118 43 25 2 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9KT84 0.000119 46 32 2 84 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1CI99 0.00012 45 29 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZFM0 0.00012 45 29 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis
Q1C6W3 0.00012 45 29 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pestis bv. Antiqua (strain Antiqua)
P10576 0.00012 46 30 4 110 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q2T8Y6 0.000121 45 29 3 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0HIF6 0.000122 45 32 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Shewanella sp. (strain MR-4)
Q669T5 0.000123 45 29 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q3A5A8 0.000137 45 31 3 103 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q9HU19 0.000143 45 29 3 104 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8F3H4 0.000145 45 28 3 113 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
P62643 0.000145 45 28 3 113 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07440
Feature type CDS
Gene kdpE
Product two-component system response regulator KdpE
Location 157856 - 158539 (strand: 1)
Length 684 (nucleotides) / 227 (amino acids)

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_760
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)		 TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07667 two-component system, OmpR family, KDP operon response regulator KdpE Two-component system
Quorum sensing		 -

Protein Sequence

MTTVLIIEDEKGIRRLLRTALEGDSVRVFEAEDLARGLVEAATRKPDLVILDLGLPDGDGITFVQEFRQWSSVPVLVLSARDSEHDKIAALDAGADDYMTKPFGVGELQARLRVLMRRYPGSEKNDPVYEFGDICVDIAGRQVRKGGEEVHLTPIEFRLLTILIGHSGKVLTQRQLLNEVWGPNAVEHAHYLRIYMGHLRQKLETDPARPQHFITETGIGYRFVSIP

Flanking regions ( +/- flanking 50bp)

CGTCTACCCTGTGAAGACCCGCCCGTGATTGATGAAGATGATAACCCGTTGTGACCACTGTACTGATTATTGAAGATGAAAAAGGGATCCGCCGCCTTCTGCGCACTGCGCTGGAAGGGGATTCTGTGCGTGTGTTTGAAGCGGAAGACCTGGCACGCGGGCTGGTGGAAGCGGCGACCCGCAAACCGGATCTGGTGATCCTTGATCTGGGTCTGCCGGACGGTGACGGCATCACCTTTGTGCAGGAATTCCGTCAGTGGAGTTCCGTGCCGGTGCTGGTGCTTTCCGCCCGTGACAGTGAGCATGACAAAATTGCCGCCCTGGATGCCGGGGCGGATGACTATATGACCAAACCCTTTGGTGTCGGGGAGTTACAGGCGCGGCTGCGGGTGCTGATGCGCCGCTATCCCGGCAGCGAAAAAAATGATCCTGTTTATGAATTCGGGGATATCTGTGTGGATATTGCCGGGCGTCAGGTCAGGAAAGGCGGGGAGGAAGTGCATCTCACACCGATTGAATTCCGCCTGCTGACCATTCTTATCGGCCACAGCGGCAAAGTACTGACTCAGCGGCAGCTGCTCAATGAAGTGTGGGGGCCGAACGCCGTCGAACACGCCCACTACCTGCGTATTTACATGGGACATCTGCGCCAGAAACTGGAAACGGATCCGGCTCGTCCTCAGCATTTCATCACCGAAACCGGTATTGGTTACCGGTTTGTATCCATCCCCTGAATACCTCCCCGGCGATTTTTTTACCCCCGTCACTGTTATAGAAAAACTGT