Homologs in group_875

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03810 FBDBKF_03810 100.0 Morganella morganii S1 fxsA FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family
EHELCC_06725 EHELCC_06725 100.0 Morganella morganii S2 fxsA FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family
LHKJJB_06585 LHKJJB_06585 100.0 Morganella morganii S3 fxsA FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family
HKOGLL_04345 HKOGLL_04345 100.0 Morganella morganii S5 fxsA FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family
F4V73_RS11060 F4V73_RS11060 83.9 Morganella psychrotolerans - FxsA family protein
PMI_RS12585 PMI_RS12585 60.1 Proteus mirabilis HI4320 - FxsA family protein

Distribution of the homologs in the orthogroup group_875

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_875

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37148 2.03e-46 151 63 1 141 3 fxsA UPF0716 protein FxsA (Fragment) Serratia marcescens
P37147 6.3e-40 135 54 3 162 1 fxsA UPF0716 protein FxsA Escherichia coli (strain K12)
O32064 2.06e-10 58 32 1 102 3 ytzA UPF0716 protein YtzA Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07050
Feature type CDS
Gene fxsA
Product FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family
Location 80246 - 80752 (strand: 1)
Length 507 (nucleotides) / 168 (amino acids)
In genomic island -

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_875
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04186 FxsA cytoplasmic membrane protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3030 General function prediction only (R) R FxsA protein affecting phage T7 exclusion by the F plasmid, UPF0716 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07113 UPF0716 protein FxsA - -

Protein Sequence

MRWLPLILICLLIYIEAVIFVHVASAIGVFMTLVLVVLTSCLGVSLVRNQGMRNLSLIQQKIQAGESPAAEMIKSVSLVLAGILLVLPGFFTDFLGLLLLLPPVQKLLVSRVLPFIRVYQPRTNPFAGNAANQGNVYEGEFERRGDTSSQRLNQSPASHNDDNPQDKP

Flanking regions ( +/- flanking 50bp)

GACAAAGGGGCGGTTTTTTACATCACAGTGCACCACATAAGGAAGACGTTATGCGTTGGTTACCCCTTATCCTCATTTGTCTGCTGATCTATATTGAGGCGGTCATTTTTGTTCACGTGGCATCCGCCATCGGTGTGTTTATGACACTGGTGCTGGTGGTACTGACATCCTGTCTCGGCGTATCTCTGGTGCGCAATCAGGGAATGCGTAATCTGAGTCTGATTCAGCAGAAAATTCAGGCGGGTGAGAGCCCTGCGGCAGAGATGATCAAAAGCGTCTCTCTGGTGCTGGCCGGTATCCTGCTGGTCCTGCCGGGCTTTTTCACCGATTTCTTAGGGCTGCTGTTGCTGCTGCCGCCGGTACAGAAACTGCTGGTGTCCCGTGTGCTGCCGTTTATCCGCGTGTATCAGCCGCGGACGAACCCGTTCGCCGGTAACGCGGCAAACCAGGGGAATGTGTACGAAGGGGAATTTGAGCGCCGGGGTGATACATCATCACAGCGGCTCAACCAGTCACCGGCGTCACACAATGATGATAATCCGCAGGATAAACCCTGATATCTGAACAGTTTGGACAGAGACCGTGAAATTTCGTATTTTTTTCGTCT