Homologs in group_3511

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17925 FBDBKF_17925 100.0 Morganella morganii S1 - DUF2857 domain-containing protein
EHELCC_06410 EHELCC_06410 100.0 Morganella morganii S2 - DUF2857 domain-containing protein
LHKJJB_19330 LHKJJB_19330 100.0 Morganella morganii S3 - DUF2857 domain-containing protein
HKOGLL_04660 HKOGLL_04660 100.0 Morganella morganii S5 - DUF2857 domain-containing protein

Distribution of the homologs in the orthogroup group_3511

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3511

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06730
Feature type CDS
Gene -
Product DUF2857 domain-containing protein
Location 11924 - 12058 (strand: -1)
Length 135 (nucleotides) / 44 (amino acids)
In genomic island GI4

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3511
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MIPSLNYAVLTDALRALKEDNIHHRESLGLTFDEMNTLRTTLVL

Flanking regions ( +/- flanking 50bp)

TCAACCTCAAATTAGCCAACCGCTGAAGTGTTTAAGGAAGGTCCGAAATCATGATTCCGTCTCTGAATTACGCCGTATTAACAGATGCCCTGCGTGCGCTGAAAGAAGACAATATTCACCATCGTGAATCTCTGGGACTCACCTTCGACGAAATGAATACCCTCAGGACAACACTGGTGCTTTAATGAAAAAACGAAATTTCAGTGCAGAATTCAGACGTGAATCCGCTCAGTTA