Homologs in group_3507

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_06410 EHELCC_06410 100.0 Morganella morganii S2 - DUF2857 domain-containing protein
NLDBIP_06730 NLDBIP_06730 100.0 Morganella morganii S4 - DUF2857 domain-containing protein
LHKJJB_19330 LHKJJB_19330 100.0 Morganella morganii S3 - DUF2857 domain-containing protein
HKOGLL_04660 HKOGLL_04660 100.0 Morganella morganii S5 - DUF2857 domain-containing protein

Distribution of the homologs in the orthogroup group_3507

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3507

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_17925
Feature type CDS
Gene -
Product DUF2857 domain-containing protein
Location 24191 - 24325 (strand: 1)
Length 135 (nucleotides) / 44 (amino acids)

Contig

Accession contig_31
Length 36259 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3507
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MIPSLNYAVLTDALRALKEDNIHHRESLGLTFDEMNTLRTTLVL

Flanking regions ( +/- flanking 50bp)

TCAACCTCAAATTAGCCAACCGCTGAAGTGTTTAAGGAAGGTCCGAAATCATGATTCCGTCTCTGAATTACGCCGTATTAACAGATGCCCTGCGTGCGCTGAAAGAAGACAATATTCACCATCGTGAATCTCTGGGACTCACCTTCGACGAAATGAATACCCTCAGGACAACACTGGTGCTTTAATGAAAAAACGAAATTTCAGTGCAGAATTCAGACGTGAATCCGCTCAGTTA