Homologs in group_3514

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17955 FBDBKF_17955 100.0 Morganella morganii S1 - Antirestriction protein
EHELCC_06380 EHELCC_06380 100.0 Morganella morganii S2 - Antirestriction protein
LHKJJB_19300 LHKJJB_19300 100.0 Morganella morganii S3 - Antirestriction protein
HKOGLL_04690 HKOGLL_04690 100.0 Morganella morganii S5 - Antirestriction protein

Distribution of the homologs in the orthogroup group_3514

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3514

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06700
Feature type CDS
Gene -
Product Antirestriction protein
Location 8027 - 8203 (strand: 1)
Length 177 (nucleotides) / 58 (amino acids)
In genomic island GI4

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3514
Orthogroup size 5
N. genomes 5

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4227 Replication, recombination and repair (L) L Antirestriction protein ArdC

Protein Sequence

MITSLHTQTSASNTATATSVSPLDPSGSSKTKFSKTRTDIYQIVTDLIITTLEVGVKP

Flanking regions ( +/- flanking 50bp)

CTGTCAGGCGATACGAAGATGAAAATCACATTACTGATGGAGAAAAAACTATGATCACTTCCTTGCATACTCAGACAAGTGCCTCTAACACCGCAACGGCGACCAGCGTATCCCCGCTGGACCCGTCAGGCTCCTCAAAAACGAAATTTTCCAAAACCAGAACCGATATTTATCAGATCGTTACCGACCTCATCATTACCACACTGGAAGTAGGCGTTAAACCCTGAGTGTGTCCGTGGCAGCGCGTACCGGGTATGTCCGGCATGCCTTCCAACTA