Homologs in group_3246

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04900 FBDBKF_04900 100.0 Morganella morganii S1 arsC glutaredoxin-dependent arsenate reductase
EHELCC_06190 EHELCC_06190 100.0 Morganella morganii S2 arsC glutaredoxin-dependent arsenate reductase
LHKJJB_03390 LHKJJB_03390 100.0 Morganella morganii S3 arsC glutaredoxin-dependent arsenate reductase
HKOGLL_06865 HKOGLL_06865 100.0 Morganella morganii S5 arsC glutaredoxin-dependent arsenate reductase

Distribution of the homologs in the orthogroup group_3246

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3246

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P52147 4.93e-69 207 71 0 133 3 arsC Arsenate reductase Escherichia coli
P74984 3.66e-68 205 75 0 130 3 arsC Arsenate reductase Yersinia enterocolitica
O50595 4.32e-68 205 71 0 133 3 arsC Arsenate reductase Acidiphilium multivorum (strain DSM 11245 / JCM 8867 / NBRC 100883 / AIU 301)
P0AB97 2.81e-67 202 70 0 133 3 arsC Arsenate reductase Shigella flexneri
P0AB96 2.81e-67 202 70 0 133 2 arsC Arsenate reductase Escherichia coli (strain K12)
P08692 5.49e-67 202 71 0 133 1 arsC Arsenate reductase Escherichia coli
Q92R44 7.3e-53 166 56 0 130 1 arsC Arsenate reductase Rhizobium meliloti (strain 1021)
Q6ZEM6 1.19e-39 133 49 0 132 1 arsI1 Arsenate reductase ArsI1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q6YRW7 2.56e-39 132 49 0 130 1 arsI2 Arsenate reductase ArsI2 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P76569 3.43e-25 95 42 1 115 1 yfgD Uncharacterized protein YfgD Escherichia coli (strain K12)
P44589 4.78e-19 79 38 1 114 3 arsC Arsenate reductase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0CF86 3.78e-17 74 64 0 51 3 yfjU Putative arsenate reductase-like protein Escherichia coli (strain K12)
P0CF87 3.78e-17 74 64 0 51 3 yfjU Putative arsenate reductase Escherichia coli (strain K12)
P63622 3.09e-15 70 31 1 117 3 arsC Arsenate reductase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P63621 3.09e-15 70 31 1 117 3 arsC Arsenate reductase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P95354 4.07e-14 66 32 1 99 3 arsC Putative arsenate reductase Neisseria gonorrhoeae
O32175 8.51e-09 53 27 1 97 3 yusI Uncharacterized protein YusI Bacillus subtilis (strain 168)
P19434 2.11e-08 52 25 2 117 3 None Uncharacterized protein in glnII region Streptomyces viridochromogenes

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06510
Feature type CDS
Gene arsC
Product glutaredoxin-dependent arsenate reductase
Location 288554 - 288976 (strand: -1)
Length 423 (nucleotides) / 140 (amino acids)
In genomic island -

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3246
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF03960 ArsC family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1393 Inorganic ion transport and metabolism (P) P Arsenate reductase or related protein, glutaredoxin family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00537 arsenate reductase (glutaredoxin) [EC:1.20.4.1] - -

Protein Sequence

MNEITIYHNPNCGTSRNTLAMIRNSGVEPTIIYYLETPPAKDVLVQLIADMKITARELLRKNVEPYKQLNLENNLYSDEQLIDFMLHYPILINRPIVVTPLGVKLCRPSEVVLDILPNQQQSEFIKEDGQIVIGSHDVKM

Flanking regions ( +/- flanking 50bp)

ACTCGTTGCTTTAGTACTTCGACTTTCACTGTTAAATTAAAGGTAACTCCATGAATGAGATCACTATCTACCATAACCCCAATTGTGGCACTTCGCGTAACACCCTTGCAATGATCCGCAATAGTGGCGTTGAGCCAACGATTATTTATTACCTGGAAACACCTCCGGCTAAGGATGTGTTAGTGCAACTTATTGCAGATATGAAAATTACAGCGAGGGAGCTATTACGAAAAAATGTTGAGCCGTATAAGCAATTAAATTTAGAAAATAACCTTTATTCCGATGAGCAATTGATCGATTTTATGTTGCACTACCCGATACTGATTAATAGGCCGATTGTCGTCACTCCGCTGGGCGTAAAGTTGTGTAGGCCTTCAGAGGTAGTGTTAGATATATTGCCTAATCAGCAACAAAGTGAATTTATCAAGGAAGATGGTCAGATAGTGATTGGTAGTCACGATGTAAAAATGTAAATTTTCCCTTTCTTTGCCCGCTATATCCGTTACAGCAATGATTTTGTCAC