Homologs in group_883

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04540 FBDBKF_04540 100.0 Morganella morganii S1 arsR DNA-binding transcriptional regulator, ArsR family
EHELCC_05830 EHELCC_05830 100.0 Morganella morganii S2 arsR DNA-binding transcriptional regulator, ArsR family
LHKJJB_03030 LHKJJB_03030 100.0 Morganella morganii S3 arsR DNA-binding transcriptional regulator, ArsR family
HKOGLL_06505 HKOGLL_06505 100.0 Morganella morganii S5 arsR DNA-binding transcriptional regulator, ArsR family
F4V73_RS08995 F4V73_RS08995 86.7 Morganella psychrotolerans - metalloregulator ArsR/SmtB family transcription factor
PMI_RS10365 PMI_RS10365 71.8 Proteus mirabilis HI4320 - metalloregulator ArsR/SmtB family transcription factor

Distribution of the homologs in the orthogroup group_883

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_883

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8UAA8 3.9e-29 104 54 1 98 1 bigR Biofilm growth-associated repressor Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9PFB1 4.29e-27 99 52 1 98 1 bigR Biofilm growth-associated repressor Xylella fastidiosa (strain 9a5c)
Q87AD5 5.05e-27 98 52 1 98 3 bigR Biofilm growth-associated repressor Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P77295 7.67e-20 80 40 1 98 1 ygaV Probable HTH-type transcriptional regulator YgaV Escherichia coli (strain K12)
P52695 1.09e-18 77 36 0 102 1 hlyU Transcriptional activator HlyU Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P28267 1.94e-15 69 40 0 89 4 nolR Nodulation protein NolR Rhizobium meliloti
O69711 4.34e-14 65 44 1 89 1 nmtR HTH-type transcriptional regulator NmtR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O31844 9.93e-14 64 47 0 76 1 czrA HTH-type transcriptional repressor CzrA Bacillus subtilis (strain 168)
P30346 1.72e-10 57 40 0 75 4 merR Probable mercury resistance operon repressor Streptomyces lividans
Q55940 3.13e-10 56 35 0 80 1 ziaR Transcriptional repressor SmtB homolog Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O08446 5.28e-10 57 43 1 86 1 Rv0324 HTH-type transcriptional regulator Rv0324 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q58721 8.79e-09 51 32 1 78 4 MJ1325 Uncharacterized HTH-type transcriptional regulator MJ1325 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O53838 1.48e-08 52 37 0 72 1 kmtR HTH-type transcriptional regulator KmtR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMI7 5.15e-08 50 38 1 78 1 Rv0081 Uncharacterized HTH-type transcriptional regulator Rv0081 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMI6 5.15e-08 50 38 1 78 2 MT0088 Uncharacterized HTH-type transcriptional regulator MT0088 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P30340 8.03e-07 47 35 0 80 1 smtB Transcriptional repressor SmtB Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P9WMI5 8.9e-07 47 33 0 69 1 smtB HTH-type transcriptional repressor SmtB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMI4 8.9e-07 47 33 0 69 3 smtB HTH-type transcriptional repressor SmtB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WMI9 1.38e-06 46 32 1 90 1 cmtR HTH-type transcriptional regulator CmtR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMI8 1.38e-06 46 32 1 90 3 cmtR HTH-type transcriptional regulator CmtR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67732 1.38e-06 46 32 1 90 3 cmtR HTH-type transcriptional regulator CmtR Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
O32242 4.42e-06 44 28 0 64 2 sdpR Transcriptional repressor SdpR Bacillus subtilis (strain 168)
Q01256 4.72e-06 44 37 0 70 4 arsR Arsenical resistance operon repressor Staphylococcus xylosus
P96677 6.65e-06 44 36 1 71 1 aseR HTH-type transcriptional repressor AseR Bacillus subtilis (strain 168)
P37374 1.05e-05 44 36 3 76 4 cadC Cadmium resistance transcriptional regulatory protein CadC homolog Staphylococcus aureus
P30338 1.78e-05 43 36 0 65 4 arsR Arsenical resistance operon repressor Staphylococcus aureus
P30339 2.54e-05 43 30 2 78 3 cadC Cadmium resistance transcriptional regulatory protein CadC Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
O31480 6.63e-05 42 35 0 67 4 yczG Uncharacterized HTH-type transcriptional regulator YczG Bacillus subtilis (strain 168)
O52026 8.01e-05 42 37 3 82 2 arsR2 Putative arsenical resistance operon repressor ArsR2 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
O31178 0.00018 40 36 2 72 1 pagR Transcriptional repressor PagR Bacillus anthracis
P20047 0.000182 41 29 2 78 1 cadC Cadmium resistance transcriptional regulatory protein CadC Staphylococcus aureus
Q56405 0.000374 40 27 1 76 3 cadC Cadmium resistance transcriptional regulatory protein CadC Listeria monocytogenes

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_06150
Feature type CDS
Gene arsR
Product DNA-binding transcriptional regulator, ArsR family
Location 204554 - 204871 (strand: -1)
Length 318 (nucleotides) / 105 (amino acids)

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_883
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01022 Bacterial regulatory protein, arsR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0640 Transcription (K) K DNA-binding transcriptional regulator, ArsR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K22042 ArsR family transcriptional regulator, virulence genes transcriptional regulator - -

Protein Sequence

MTPTQLTDMQEAATGVAALLKTLGNPDRLLLLCQLSQGECNVSELEERTGINQPTLSQQLTVLRNEGLVHTRREGKRIYYSVADEKVLILLTTLYQLYCPEKQGK

Flanking regions ( +/- flanking 50bp)

TTGCAAAATAATATTATATTTAATTATATAATGTCGTAAGGAATAAATTCATGACACCAACACAGCTTACCGATATGCAGGAAGCCGCCACCGGCGTTGCTGCCCTGCTGAAAACACTGGGGAATCCGGATCGTCTGCTGCTGCTCTGTCAGCTGAGTCAGGGGGAGTGCAATGTCAGCGAACTGGAGGAGCGGACCGGCATCAATCAGCCGACGCTGTCACAGCAACTGACAGTTCTGCGCAATGAAGGACTGGTGCACACCCGGCGTGAGGGAAAACGTATCTATTATTCCGTGGCAGATGAAAAAGTCCTGATATTGCTCACCACGCTGTATCAGCTTTATTGTCCTGAAAAACAAGGAAAATAATATGATTATTGATAGCGCGGCTTTTACGCCGGTCAGTGCGGCACTGGGCG