Homologs in group_1695

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10990 FBDBKF_10990 100.0 Morganella morganii S1 eco serine protease inhibitor ecotin
EHELCC_05235 EHELCC_05235 100.0 Morganella morganii S2 eco serine protease inhibitor ecotin
LHKJJB_02435 LHKJJB_02435 100.0 Morganella morganii S3 eco serine protease inhibitor ecotin
HKOGLL_15815 HKOGLL_15815 100.0 Morganella morganii S5 eco serine protease inhibitor ecotin
F4V73_RS08235 F4V73_RS08235 88.5 Morganella psychrotolerans eco serine protease inhibitor ecotin
PMI_RS09635 PMI_RS09635 55.7 Proteus mirabilis HI4320 eco serine protease inhibitor ecotin

Distribution of the homologs in the orthogroup group_1695

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1695

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57M90 1.36e-43 145 43 2 167 3 eco Ecotin Salmonella choleraesuis (strain SC-B67)
B5BDZ1 1.46e-42 142 46 0 140 3 eco Ecotin Salmonella paratyphi A (strain AKU_12601)
Q5PI36 1.46e-42 142 46 0 140 3 eco Ecotin Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8GCA1 1.97e-42 142 50 0 130 3 eco Ecotin Serratia proteamaculans (strain 568)
A1JL79 3.94e-42 141 46 0 136 3 eco Ecotin Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8ZNH4 6.23e-42 140 45 0 140 3 eco Ecotin Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RC88 6.23e-42 140 45 0 140 3 eco Ecotin Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R236 6.23e-42 140 45 0 140 3 eco Ecotin Salmonella enteritidis PT4 (strain P125109)
Q8Z568 6.65e-42 140 45 0 140 3 eco Ecotin Salmonella typhi
B7LJV0 7.21e-42 140 41 3 174 3 eco Ecotin Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q821B1 7.37e-42 140 40 3 174 3 eco Ecotin Shigella flexneri
Q0T2R6 7.37e-42 140 40 3 174 3 eco Ecotin Shigella flexneri serotype 5b (strain 8401)
B7NN20 7.78e-42 140 42 3 171 3 eco Ecotin Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFC2 7.78e-42 140 42 3 171 3 eco Ecotin Escherichia coli O45:K1 (strain S88 / ExPEC)
Q31Z32 1.5e-41 140 40 3 174 3 eco Ecotin Shigella boydii serotype 4 (strain Sb227)
B2TV26 1.5e-41 140 40 3 174 3 eco Ecotin Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YX01 1.5e-41 140 41 3 171 3 eco Ecotin Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE46 1.5e-41 140 41 3 171 3 eco Ecotin Escherichia coli O157:H7
B1LKV6 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli (strain SMS-3-5 / SECEC)
B6I1A7 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli (strain SE11)
B7N5H1 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8CVW3 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFN2 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXP0 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli O81 (strain ED1a)
B7LAN3 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli (strain 55989 / EAEC)
B7UFM3 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZP31 1.56e-41 139 41 3 171 3 eco Ecotin Escherichia coli O139:H28 (strain E24377A / ETEC)
P23827 1.74e-41 139 41 3 171 1 eco Ecotin Escherichia coli (strain K12)
B1IY63 1.74e-41 139 41 3 171 3 eco Ecotin Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A271 1.74e-41 139 41 3 171 3 eco Ecotin Escherichia coli O9:H4 (strain HS)
B1X8A5 1.74e-41 139 41 3 171 3 eco Ecotin Escherichia coli (strain K12 / DH10B)
C4ZU52 1.74e-41 139 41 3 171 3 eco Ecotin Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5Q0 1.74e-41 139 41 3 171 3 eco Ecotin Escherichia coli O8 (strain IAI1)
Q3YZZ8 1.03e-40 137 40 3 171 3 eco Ecotin Shigella sonnei (strain Ss046)
Q1R9K8 2.15e-40 137 41 3 171 3 eco Ecotin Escherichia coli (strain UTI89 / UPEC)
B1JSA0 2.22e-40 137 46 1 137 1 eco Ecotin Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ8 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNJ2 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pestis (strain Pestoides F)
Q1CFY7 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pestis bv. Antiqua (strain Nepal516)
A9R289 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGS0 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pestis
B2K9A0 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H9 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF8 2.22e-40 137 46 1 137 3 eco Ecotin Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B0KU25 3.33e-39 134 48 1 127 3 eco Ecotin Pseudomonas putida (strain GB-1)
A5W3S6 4.09e-39 133 46 1 131 3 eco Ecotin Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A9MJZ3 5.26e-39 133 44 1 144 3 eco Ecotin Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q88IC7 1.48e-38 132 46 1 131 3 eco Ecotin Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3KCZ4 4.75e-36 125 40 3 159 3 eco Ecotin Pseudomonas fluorescens (strain Pf0-1)
Q4KC31 6.58e-36 125 38 2 171 3 eco Ecotin Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q02NQ8 1.15e-35 124 44 1 127 3 eco Ecotin Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZW2 1.29e-35 124 44 1 127 3 eco Ecotin Pseudomonas aeruginosa (strain LESB58)
B1J8K6 1.84e-34 121 42 1 133 3 eco Ecotin Pseudomonas putida (strain W619)
Q9I088 3.49e-34 120 43 1 124 3 eco Ecotin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UMT9 2.22e-33 119 41 1 136 3 RF_0268 Ecotin-like protein Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q1H1S3 5.31e-33 118 44 1 128 3 Mfla_1296 Putative ecotin-like protein Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8EEQ7 5.34e-29 108 39 1 125 3 eco Ecotin Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4H823 6.53e-25 97 39 3 123 3 LbrM15_V2.0540 Ecotin-like protein 2 Leishmania braziliensis
Q4QFD4 2.58e-24 95 42 5 125 3 LmjF15.0510 Ecotin-like protein 2 Leishmania major
A4HWE9 3.15e-22 90 40 5 125 3 LinJ15.0530 Ecotin-like protein 2 Leishmania infantum
Q4D4Y5 6.51e-20 84 34 3 123 3 Tc00.1047053508533.40 Ecotin-like protein 2 Trypanosoma cruzi (strain CL Brener)
A4H804 5.12e-19 81 35 4 134 3 ISP1 Ecotin-like protein 1 Leishmania braziliensis
Q4QFF0 1.31e-16 75 33 4 137 3 ISP1 Ecotin-like protein 1 Leishmania major
A4HWD2 3.08e-16 74 32 4 134 3 ISP1 Ecotin-like protein 1 Leishmania infantum
Q57ZQ7 3.73e-14 69 30 3 120 3 Tb927.5.1880 Ecotin-like protein 2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
Q4QFD3 6.07e-14 71 30 5 130 3 LmjF15.0520 Ecotin-like protein 3 Leishmania major
A4HWF0 1.3e-13 70 28 5 133 3 LinJ15.0540 Ecotin-like protein 3 Leishmania infantum
Q7P9E2 9.8e-12 60 48 1 64 5 rsib_orf.1082 Putative ecotin-like protein Rickettsia sibirica (strain ATCC VR-151 / 246)
Q92GV5 9.8e-12 60 48 1 64 5 RC1017 Putative ecotin-like protein Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A4H824 1.14e-10 62 32 8 144 3 LbrM15_V2.0550 Ecotin-like protein 3 Leishmania braziliensis
A4CX36 1.89e-10 60 25 8 172 3 WH7805_09909 Putative ecotin-like protein Synechococcus sp. (strain WH7805)
Q0I672 1.2e-09 57 26 8 178 3 sync_2863 Putative ecotin-like protein Synechococcus sp. (strain CC9311)
P59839 1.52e-08 54 28 8 156 3 eco Ecotin Prochlorococcus marinus (strain MIT 9313)
Q57ZP2 1.96e-06 48 25 3 140 3 Tb927.5.1730 Ecotin-like protein 4 Trypanosoma brucei brucei (strain 927/4 GUTat10.1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_05555
Feature type CDS
Gene eco
Product serine protease inhibitor ecotin
Location 79624 - 80148 (strand: -1)
Length 525 (nucleotides) / 174 (amino acids)
In genomic island -

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1695
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03974 Ecotin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4574 Posttranslational modification, protein turnover, chaperones (O) O Serine protease inhibitor ecotin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08276 ecotin - -

Protein Sequence

MKKLILPVMAMFAAAGAYAEEAKTTDMEPLKIVKTDNGMSELKHFPQAASDQVRHVIAVEPKADEGQYKIELVIGKKQMVDCNHQWFGGTLTQKTVDGFGYDYYETGDLTGPMSTMMGCLNNEKREAFVSANLGDEAFVRYNSRLPVVVYAPKDVEVKYRIWSTDNQLLDAPAK

Flanking regions ( +/- flanking 50bp)

ATGAGACGATTTCATAATCAAATGTACTTATAAAACAAGGTAATTATTTGATGAAAAAATTGATCCTTCCTGTTATGGCCATGTTCGCTGCCGCAGGCGCTTATGCTGAAGAAGCAAAAACCACTGATATGGAGCCGCTGAAGATTGTGAAAACCGACAACGGCATGAGTGAGCTGAAACACTTCCCGCAGGCTGCGTCAGATCAGGTTCGCCATGTGATTGCCGTGGAGCCGAAAGCCGATGAAGGGCAGTACAAAATTGAACTGGTGATCGGTAAAAAACAGATGGTGGACTGTAACCACCAGTGGTTTGGCGGTACGCTGACACAGAAAACCGTTGATGGTTTCGGCTATGACTATTATGAGACCGGCGACTTAACCGGGCCGATGTCCACCATGATGGGCTGCCTCAATAATGAAAAACGCGAAGCGTTTGTCAGCGCTAACCTGGGTGACGAAGCATTCGTCCGTTACAACAGCCGCCTGCCGGTTGTGGTGTACGCCCCGAAAGATGTGGAAGTAAAATACCGTATCTGGAGCACGGATAATCAGCTGCTGGATGCACCGGCCAAATAATCCGTTAATATCTGACACATAAAACACGGCGCCTGCCGTGTTTTTTGTTT