Homologs in group_1695

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10990 FBDBKF_10990 88.5 Morganella morganii S1 eco serine protease inhibitor ecotin
EHELCC_05235 EHELCC_05235 88.5 Morganella morganii S2 eco serine protease inhibitor ecotin
NLDBIP_05555 NLDBIP_05555 88.5 Morganella morganii S4 eco serine protease inhibitor ecotin
LHKJJB_02435 LHKJJB_02435 88.5 Morganella morganii S3 eco serine protease inhibitor ecotin
HKOGLL_15815 HKOGLL_15815 88.5 Morganella morganii S5 eco serine protease inhibitor ecotin
PMI_RS09635 PMI_RS09635 58.9 Proteus mirabilis HI4320 eco serine protease inhibitor ecotin

Distribution of the homologs in the orthogroup group_1695

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1695

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q57M90 8.81e-43 143 46 0 136 3 eco Ecotin Salmonella choleraesuis (strain SC-B67)
B5BDZ1 1.11e-42 143 46 0 136 3 eco Ecotin Salmonella paratyphi A (strain AKU_12601)
Q5PI36 1.11e-42 143 46 0 136 3 eco Ecotin Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A1JL79 2.66e-42 142 45 0 136 3 eco Ecotin Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8Z568 4.53e-42 141 45 0 136 3 eco Ecotin Salmonella typhi
Q8ZNH4 4.99e-42 141 45 0 136 3 eco Ecotin Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RC88 4.99e-42 141 45 0 136 3 eco Ecotin Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R236 4.99e-42 141 45 0 136 3 eco Ecotin Salmonella enteritidis PT4 (strain P125109)
A8GCA1 4.18e-41 139 47 0 130 3 eco Ecotin Serratia proteamaculans (strain 568)
B7LJV0 5.99e-41 139 44 0 136 3 eco Ecotin Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NN20 8.39e-41 138 45 0 133 3 eco Ecotin Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MFC2 8.39e-41 138 45 0 133 3 eco Ecotin Escherichia coli O45:K1 (strain S88 / ExPEC)
Q821B1 8.66e-41 138 43 0 136 3 eco Ecotin Shigella flexneri
Q0T2R6 8.66e-41 138 43 0 136 3 eco Ecotin Shigella flexneri serotype 5b (strain 8401)
B5YX01 1.37e-40 137 44 0 133 3 eco Ecotin Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE46 1.37e-40 137 44 0 133 3 eco Ecotin Escherichia coli O157:H7
B1LKV6 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli (strain SMS-3-5 / SECEC)
B6I1A7 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli (strain SE11)
B7N5H1 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8CVW3 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFN2 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MXP0 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli O81 (strain ED1a)
B7LAN3 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli (strain 55989 / EAEC)
B7UFM3 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZP31 1.52e-40 137 44 0 133 3 eco Ecotin Escherichia coli O139:H28 (strain E24377A / ETEC)
P23827 1.59e-40 137 44 0 133 1 eco Ecotin Escherichia coli (strain K12)
B1IY63 1.59e-40 137 44 0 133 3 eco Ecotin Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A271 1.59e-40 137 44 0 133 3 eco Ecotin Escherichia coli O9:H4 (strain HS)
B1X8A5 1.59e-40 137 44 0 133 3 eco Ecotin Escherichia coli (strain K12 / DH10B)
C4ZU52 1.59e-40 137 44 0 133 3 eco Ecotin Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5Q0 1.59e-40 137 44 0 133 3 eco Ecotin Escherichia coli O8 (strain IAI1)
Q31Z32 1.65e-40 137 43 0 136 3 eco Ecotin Shigella boydii serotype 4 (strain Sb227)
B2TV26 1.65e-40 137 43 0 136 3 eco Ecotin Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q3YZZ8 5.15e-40 136 44 0 133 3 eco Ecotin Shigella sonnei (strain Ss046)
B0KU25 8.11e-40 135 48 1 127 3 eco Ecotin Pseudomonas putida (strain GB-1)
A9MJZ3 8.96e-40 135 44 1 144 3 eco Ecotin Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1R9K8 1.98e-39 135 44 0 133 3 eco Ecotin Escherichia coli (strain UTI89 / UPEC)
B1JSA0 2.77e-39 134 44 1 137 1 eco Ecotin Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ8 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNJ2 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pestis (strain Pestoides F)
Q1CFY7 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pestis bv. Antiqua (strain Nepal516)
A9R289 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGS0 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pestis
B2K9A0 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H9 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF8 2.77e-39 134 44 1 137 3 eco Ecotin Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A5W3S6 6.46e-39 133 45 1 131 3 eco Ecotin Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88IC7 2.28e-38 132 45 1 131 3 eco Ecotin Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q02NQ8 4.8e-36 126 43 1 127 3 eco Ecotin Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZW2 5.71e-36 125 43 1 127 3 eco Ecotin Pseudomonas aeruginosa (strain LESB58)
B1J8K6 2.29e-35 124 42 1 133 3 eco Ecotin Pseudomonas putida (strain W619)
Q4KC31 2.62e-35 124 44 1 127 3 eco Ecotin Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3KCZ4 5.24e-35 123 43 2 128 3 eco Ecotin Pseudomonas fluorescens (strain Pf0-1)
Q9I088 1.7e-34 122 42 1 127 3 eco Ecotin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q1H1S3 2.79e-33 119 44 1 128 3 Mfla_1296 Putative ecotin-like protein Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q4UMT9 7.53e-31 113 39 1 138 3 RF_0268 Ecotin-like protein Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q8EEQ7 9.59e-29 108 36 2 143 3 eco Ecotin Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4H823 1.42e-21 89 36 3 123 3 LbrM15_V2.0540 Ecotin-like protein 2 Leishmania braziliensis
Q4QFD4 2.52e-21 88 39 5 125 3 LmjF15.0510 Ecotin-like protein 2 Leishmania major
A4HWE9 7.19e-20 84 39 5 125 3 LinJ15.0530 Ecotin-like protein 2 Leishmania infantum
Q4D4Y5 6.1e-18 79 35 4 123 3 Tc00.1047053508533.40 Ecotin-like protein 2 Trypanosoma cruzi (strain CL Brener)
A4H804 6.65e-17 76 33 4 134 3 ISP1 Ecotin-like protein 1 Leishmania braziliensis
Q4QFF0 1.08e-15 73 33 4 137 3 ISP1 Ecotin-like protein 1 Leishmania major
A4HWD2 4.64e-15 72 32 4 134 3 ISP1 Ecotin-like protein 1 Leishmania infantum
Q0I672 6.08e-12 64 28 6 144 3 sync_2863 Putative ecotin-like protein Synechococcus sp. (strain CC9311)
Q4QFD3 8.42e-12 65 28 4 131 3 LmjF15.0520 Ecotin-like protein 3 Leishmania major
Q7P9E2 3.83e-11 59 46 1 64 5 rsib_orf.1082 Putative ecotin-like protein Rickettsia sibirica (strain ATCC VR-151 / 246)
Q92GV5 3.83e-11 59 46 1 64 5 RC1017 Putative ecotin-like protein Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q57ZQ7 5.08e-11 61 29 4 121 3 Tb927.5.1880 Ecotin-like protein 2 Trypanosoma brucei brucei (strain 927/4 GUTat10.1)
A4CX36 2.14e-10 60 28 7 139 3 WH7805_09909 Putative ecotin-like protein Synechococcus sp. (strain WH7805)
A4HWF0 3.28e-10 61 26 4 128 3 LinJ15.0540 Ecotin-like protein 3 Leishmania infantum
P59839 1.66e-07 52 28 7 139 3 eco Ecotin Prochlorococcus marinus (strain MIT 9313)
A4H824 4.86e-07 52 25 5 127 3 LbrM15_V2.0550 Ecotin-like protein 3 Leishmania braziliensis
Q57ZP2 2.13e-05 46 28 4 108 3 Tb927.5.1730 Ecotin-like protein 4 Trypanosoma brucei brucei (strain 927/4 GUTat10.1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08235
Feature type CDS
Gene eco
Product serine protease inhibitor ecotin
Location 1712074 - 1712637 (strand: -1)
Length 564 (nucleotides) / 187 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1695
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03974 Ecotin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4574 Posttranslational modification, protein turnover, chaperones (O) O Serine protease inhibitor ecotin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08276 ecotin - -

Protein Sequence

MKKLILPVMAMLVAAGAYAEDTKSTTQVPMKIVKTDTTKAVPLIEVKTDNGMSELKHFPQAASDMVRHVIAVEPKADEGLYKIELVVGKKQMVDCNHQWFGASLTQKTVEGFGYDYYETSALTGPMSTMMGCLNNEKREAFVSANMGDEAFVRYNSRLPVVVYAPKDVDVKYRIWSTDNQLADAPAK

Flanking regions ( +/- flanking 50bp)

ATGAGATGAGTTCATAATTAAATGTACGTACAAAATAAGGTGATTACTTGATGAAAAAATTAATTCTTCCTGTGATGGCGATGCTTGTTGCCGCCGGCGCTTATGCGGAAGACACAAAATCAACGACACAGGTGCCAATGAAGATTGTGAAAACTGACACAACGAAAGCCGTGCCACTGATTGAAGTTAAAACCGACAACGGGATGAGTGAACTGAAACATTTCCCGCAGGCTGCATCTGATATGGTTCGCCATGTGATTGCGGTTGAGCCGAAAGCCGATGAAGGGCTGTACAAAATTGAACTCGTGGTCGGGAAAAAACAGATGGTGGATTGTAATCATCAGTGGTTCGGCGCCAGCCTGACACAAAAAACGGTTGAAGGTTTTGGCTATGATTATTATGAAACCAGCGCATTAACCGGGCCGATGTCCACGATGATGGGCTGCCTGAACAATGAAAAACGCGAAGCATTTGTCAGCGCCAATATGGGCGATGAAGCGTTTGTCCGTTACAACAGCCGTCTGCCGGTCGTGGTTTATGCGCCGAAAGATGTGGATGTTAAATATCGCATCTGGAGTACGGATAACCAGTTAGCGGACGCACCAGCGAAATAACGGTATTAGTCTTCTCTTCAGAAACACGGCTTCGGCCGTGTTTTTTTATT