Homologs in group_2874

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11275 FBDBKF_11275 100.0 Morganella morganii S1 - DNA-binding protein
EHELCC_17940 EHELCC_17940 100.0 Morganella morganii S2 - DNA-binding protein
LHKJJB_02150 LHKJJB_02150 100.0 Morganella morganii S3 - DNA-binding protein
HKOGLL_15530 HKOGLL_15530 100.0 Morganella morganii S5 - DNA-binding protein
F4V73_RS06215 F4V73_RS06215 71.2 Morganella psychrotolerans - hypothetical protein

Distribution of the homologs in the orthogroup group_2874

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2874

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_05270
Feature type CDS
Gene -
Product DNA-binding protein
Location 32600 - 32818 (strand: -1)
Length 219 (nucleotides) / 72 (amino acids)

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2874
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Protein Sequence

MEPTDFEKWCAGELGYSPEWVMMQRKINFSGGHEYSHGEIAKRYRAWNAGVCSRLPYQTPPKGDEDEGHDAD

Flanking regions ( +/- flanking 50bp)

TTGTTTGAAAAACTTATTGGCGCGGTGAATGGCGAGGAGGAATCCTGATTATGGAACCAACGGATTTTGAAAAGTGGTGTGCGGGTGAGCTTGGCTATTCGCCGGAGTGGGTCATGATGCAGCGGAAAATAAACTTTTCCGGCGGACATGAATACAGCCATGGTGAGATTGCGAAAAGATACCGCGCATGGAATGCCGGAGTTTGCAGCAGACTGCCGTACCAGACACCGCCAAAAGGAGATGAAGATGAAGGGCACGACGCTGACTGATTTAAATAAGGCGTACAGCAAGCAAGGGCGCTATATCGCAGCTCGTTACA