Homologs in group_3353

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11365 FBDBKF_11365 100.0 Morganella morganii S1 - Transposase
EHELCC_17850 EHELCC_17850 100.0 Morganella morganii S2 - Transposase
LHKJJB_02060 LHKJJB_02060 100.0 Morganella morganii S3 - Transposase
HKOGLL_15440 HKOGLL_15440 100.0 Morganella morganii S5 - Transposase

Distribution of the homologs in the orthogroup group_3353

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3353

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_05180
Feature type CDS
Gene -
Product Transposase
Location 25357 - 25530 (strand: -1)
Length 174 (nucleotides) / 57 (amino acids)

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3353
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSIETELAYLKSGKRKVLEFIDSTPPEDVITLMSWNSQLDKLNKEILELEEQQRLAK

Flanking regions ( +/- flanking 50bp)

TGCAATCACGATAAGCGGGCAATACGGGAGATTGAAGCGGAGAGAGCGAAGTGAGCATTGAAACCGAGCTGGCTTACCTGAAATCAGGAAAAAGAAAGGTGCTTGAATTTATTGACAGCACGCCGCCGGAAGATGTTATCACCCTGATGAGCTGGAATAGCCAGCTGGACAAGCTAAACAAAGAAATTTTAGAGCTGGAAGAACAACAACGCCTCGCTAAATAGCGGGGCTTTTTATATCTACAGGAGTTAACTATGCAACCACATCAACAGCG