Homologs in group_3352

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_17850 EHELCC_17850 100.0 Morganella morganii S2 - Transposase
NLDBIP_05180 NLDBIP_05180 100.0 Morganella morganii S4 - Transposase
LHKJJB_02060 LHKJJB_02060 100.0 Morganella morganii S3 - Transposase
HKOGLL_15440 HKOGLL_15440 100.0 Morganella morganii S5 - Transposase

Distribution of the homologs in the orthogroup group_3352

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3352

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_11365
Feature type CDS
Gene -
Product Transposase
Location 75011 - 75184 (strand: 1)
Length 174 (nucleotides) / 57 (amino acids)
In genomic island GI34

Contig

Accession contig_13
Length 135581 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3352
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MSIETELAYLKSGKRKVLEFIDSTPPEDVITLMSWNSQLDKLNKEILELEEQQRLAK

Flanking regions ( +/- flanking 50bp)

TGCAATCACGATAAGCGGGCAATACGGGAGATTGAAGCGGAGAGAGCGAAGTGAGCATTGAAACCGAGCTGGCTTACCTGAAATCAGGAAAAAGAAAGGTGCTTGAATTTATTGACAGCACGCCGCCGGAAGATGTTATCACCCTGATGAGCTGGAATAGCCAGCTGGACAAGCTAAACAAAGAAATTTTAGAGCTGGAAGAACAACAACGCCTCGCTAAATAGCGGGGCTTTTTATATCTACAGGAGTTAACTATGCAACCACATCAACAGCG