Homologs in group_1491

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09625 FBDBKF_09625 100.0 Morganella morganii S1 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
EHELCC_04425 EHELCC_04425 100.0 Morganella morganii S2 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
LHKJJB_14205 LHKJJB_14205 100.0 Morganella morganii S3 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
HKOGLL_12330 HKOGLL_12330 100.0 Morganella morganii S5 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
F4V73_RS00715 F4V73_RS00715 84.1 Morganella psychrotolerans bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
PMI_RS02965 PMI_RS02965 73.7 Proteus mirabilis HI4320 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase

Distribution of the homologs in the orthogroup group_1491

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1491

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36568 0.0 631 72 1 419 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Serratia marcescens
P12677 0.0 628 70 0 418 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P53656 0.0 622 70 0 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Pseudescherichia vulneris
P12995 0.0 613 69 0 419 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Escherichia coli (strain K12)
P57379 0.0 561 59 0 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q64VX4 0.0 543 60 2 426 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain YCH46)
Q5LEY1 0.0 543 61 2 426 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
E1WTS4 0.0 542 61 1 419 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain 638R)
Q8A7T2 0.0 529 59 1 417 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
E6SRG2 0.0 526 58 3 427 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / CCUG 15421 / P 36-108)
Q89AK4 0.0 525 56 0 414 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P44426 5.81e-178 506 58 1 411 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9P0 6.15e-173 494 56 0 418 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9FCC2 2.54e-161 464 56 3 413 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P9WQ81 1.91e-148 432 54 6 417 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ80 1.91e-148 432 54 6 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4X7 1.91e-148 432 54 6 417 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45488 8.86e-148 430 53 6 420 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium leprae (strain TN)
P46395 6.14e-144 420 51 5 414 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P50277 1.44e-143 421 47 9 460 3 BIO3 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q31SA6 6.28e-91 284 39 7 421 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q74CT9 9.75e-91 285 39 11 440 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q2FVJ6 2.26e-90 284 34 10 434 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
P22805 4e-90 283 37 11 433 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Lysinibacillus sphaericus
P53555 1.56e-83 266 35 8 436 1 bioK L-Lysine--8-amino-7-oxononanoate transaminase Bacillus subtilis (strain 168)
B7GHM5 5.34e-82 262 37 9 425 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
O66557 1.32e-81 261 36 9 436 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Aquifex aeolicus (strain VF5)
Q728P4 1.16e-79 259 38 9 434 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q58696 2.04e-73 240 33 11 443 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9ZKM5 9.43e-72 235 33 10 438 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Helicobacter pylori (strain J99 / ATCC 700824)
O25627 6.25e-70 230 34 9 426 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9A3Q9 6.1e-59 202 33 14 432 1 aptA Omega-aminotransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P42588 5.68e-52 184 33 12 398 1 patA Putrescine aminotransferase Escherichia coli (strain K12)
B1XG77 5.68e-52 184 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZQY9 5.68e-52 184 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A8A4N0 5.86e-52 184 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O9:H4 (strain HS)
A8APX8 7.44e-52 184 33 12 398 3 patA Putrescine aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q31WW1 7.92e-52 183 33 12 398 3 patA Putrescine aminotransferase Shigella boydii serotype 4 (strain Sb227)
Q1R6Q7 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain UTI89 / UPEC)
B6I445 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain SE11)
A1AFZ3 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O1:K1 / APEC
B7N0M2 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O81 (strain ED1a)
B5YRB3 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAN1 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O157:H7
B7LH08 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain 55989 / EAEC)
B7MB08 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIY0 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRV6 8.18e-52 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3YXH0 8.26e-52 183 33 12 398 3 patA Putrescine aminotransferase Shigella sonnei (strain Ss046)
B1IRP4 1.19e-51 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD34 1.48e-51 183 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1LF65 1.71e-51 182 33 12 398 3 patA Putrescine aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7NJT8 2.15e-51 182 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8FDF5 2.49e-51 182 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q83JJ8 3.07e-51 182 33 12 398 3 patA Putrescine aminotransferase Shigella flexneri
Q0T0J2 3.07e-51 182 33 12 398 3 patA Putrescine aminotransferase Shigella flexneri serotype 5b (strain 8401)
B7LZM2 3.2e-51 182 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O8 (strain IAI1)
B7ND61 6.04e-51 181 33 12 398 3 patA Putrescine aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A4WEQ6 9.65e-51 181 33 13 395 3 patA Putrescine aminotransferase Enterobacter sp. (strain 638)
B7LQF8 1.4e-50 180 33 13 398 3 patA Putrescine aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A6TEB2 1e-48 175 32 12 392 3 patA Putrescine aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTY7 1.74e-48 174 32 12 392 3 patA Putrescine aminotransferase Klebsiella pneumoniae (strain 342)
Q8ZLX7 2.03e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TVV2 2.03e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella schwarzengrund (strain CVM19633)
B4T688 2.03e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella newport (strain SL254)
B5F6B4 2.03e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella agona (strain SL483)
B5REH5 2.77e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ53 2.77e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5FHV3 2.77e-48 174 33 12 387 3 patA Putrescine aminotransferase Salmonella dublin (strain CT_02021853)
B5BG29 5.71e-48 173 32 12 387 3 patA Putrescine aminotransferase Salmonella paratyphi A (strain AKU_12601)
Q5PC95 5.71e-48 173 32 12 387 3 patA Putrescine aminotransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0PYZ1 7.03e-48 173 33 12 387 3 patA Putrescine aminotransferase Salmonella paratyphi C (strain RKS4594)
Q57JP1 7.03e-48 173 33 12 387 3 patA Putrescine aminotransferase Salmonella choleraesuis (strain SC-B67)
Q9I6J2 9.81e-48 172 29 13 413 1 spuC Putrescine--pyruvate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8Z3L9 1.03e-47 172 32 12 387 3 patA Putrescine aminotransferase Salmonella typhi
B4TIU6 1.03e-47 172 32 12 387 3 patA Putrescine aminotransferase Salmonella heidelberg (strain SL476)
A7MIU0 2.49e-47 172 32 12 395 3 patA Putrescine aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
A9MPU4 2.59e-47 171 32 12 387 3 patA Putrescine aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9N5Z8 3.39e-47 171 34 9 345 3 patA Putrescine aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P33189 2.93e-46 168 29 13 437 3 yhxA Uncharacterized aminotransferase YhxA Bacillus subtilis (strain 168)
Q8EP32 9.77e-45 163 30 14 406 3 rocD Ornithine aminotransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6D6Y6 2.93e-44 163 32 14 395 3 patA Putrescine aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q92413 5.15e-44 162 29 14 410 1 otaA Ornithine aminotransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q6GKC1 6.56e-44 160 30 12 415 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MRSA252)
Q6CWC1 8.32e-44 161 30 16 432 1 CAR2 Ornithine aminotransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
P30268 1.53e-43 161 31 13 421 3 BpOF4_10225 Uncharacterized aminotransferase BpOF4_10225 Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q8NYM5 1.72e-43 160 30 13 415 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MW2)
Q6GCU1 1.72e-43 160 30 13 415 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MSSA476)
Q5HJI8 1.72e-43 160 30 13 415 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain COL)
Q8FTN2 4.42e-43 159 31 9 401 3 argD Acetylornithine aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q58131 1.06e-42 157 29 15 420 3 argD Acetylornithine aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P28269 1.1e-42 159 29 11 454 1 None Omega-amino acid--pyruvate aminotransferase Pseudomonas putida
O30508 1.74e-42 157 32 17 428 1 aruC Succinylornithine transaminase/acetylornithine aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P57600 3.37e-42 156 32 12 334 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P60296 5.32e-42 155 30 13 415 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain N315)
P60295 5.32e-42 155 30 13 415 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q7W2N9 7.17e-42 155 30 12 401 3 argD2 Acetylornithine aminotransferase 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8R7C1 7.63e-42 155 30 16 404 3 argD Acetylornithine aminotransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9I700 8.55e-42 156 26 9 440 1 bauA Beta-alanine--pyruvate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7WDN7 8.64e-42 155 30 12 401 3 argD2 Acetylornithine aminotransferase 2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q5SHH5 1.04e-41 155 31 10 396 1 lysJ [LysW]-aminoadipate semialdehyde transaminase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q93R93 3.07e-41 154 31 10 396 1 lysJ [LysW]-aminoadipate semialdehyde transaminase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q885K0 3.09e-41 154 32 16 433 3 argD1 Acetylornithine aminotransferase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q59282 4.68e-41 153 30 10 414 1 argD Acetylornithine aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9P7L5 4.98e-41 154 29 12 408 2 car2 Ornithine aminotransferase car2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q98BB7 1.11e-40 152 33 15 372 3 argD Acetylornithine aminotransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B8BBZ7 1.2e-40 154 27 12 452 3 OsI_28220 Probable gamma-aminobutyrate transaminase 3, mitochondrial Oryza sativa subsp. indica
Q7VSH3 1.63e-40 152 30 12 401 3 argD2 Acetylornithine aminotransferase 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q84P52 1.65e-40 154 28 14 425 1 GABA-TP3 Gamma aminobutyrate transaminase 3, chloroplastic Solanum lycopersicum
Q6ZCF0 2.04e-40 154 27 12 452 3 Os08g0205900 Probable gamma-aminobutyrate transaminase 3, mitochondrial Oryza sativa subsp. japonica
Q9FNK4 2.51e-40 153 29 15 424 1 DELTA-OAT Ornithine aminotransferase, mitochondrial Arabidopsis thaliana
O94562 2.77e-40 152 29 14 442 3 SPBC1773.03c Uncharacterized aminotransferase C1771.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q66B21 3.09e-40 151 34 9 338 3 astC Succinylornithine transaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FIL6 3.25e-40 151 34 9 338 3 astC Succinylornithine transaminase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9QZ63 3.28e-40 151 34 9 338 3 astC Succinylornithine transaminase Yersinia pestis bv. Antiqua (strain Angola)
Q8D0D7 3.28e-40 151 34 9 338 3 astC Succinylornithine transaminase Yersinia pestis
Q1C8B1 3.28e-40 151 34 9 338 3 astC Succinylornithine transaminase Yersinia pestis bv. Antiqua (strain Antiqua)
Q9I6M4 3.75e-40 151 30 14 406 1 davT 5-aminovalerate aminotransferase DavT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q97GH9 3.91e-40 150 29 13 393 3 argD Acetylornithine aminotransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
O66442 9.56e-40 149 28 14 399 1 argD Acetylornithine aminotransferase Aquifex aeolicus (strain VF5)
Q8Z1Z3 1.18e-39 149 31 16 416 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Salmonella typhi
Q9RW75 1.24e-39 150 30 12 394 3 lysJ [LysW]-aminoadipate semialdehyde transaminase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P59324 2.1e-39 149 33 13 350 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Yersinia pestis
Q7VMS5 2.1e-39 149 32 12 376 3 argD Acetylornithine aminotransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q8UI71 2.67e-39 149 35 9 297 3 argD Acetylornithine aminotransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4XWV5 3.46e-39 149 28 17 425 3 OAT Ornithine aminotransferase Plasmodium chabaudi chabaudi
Q87L20 3.58e-39 148 30 14 419 3 argD Acetylornithine aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q84P54 3.59e-39 150 27 15 459 1 GABA-TP1 Gamma aminobutyrate transaminase 1, mitochondrial Solanum lycopersicum
P40732 4.08e-39 148 31 16 416 1 argD Acetylornithine/succinyldiaminopimelate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P60299 5.28e-39 147 29 13 409 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MW2)
Q6GAW9 5.28e-39 147 29 13 409 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MSSA476)
P60298 5.28e-39 147 29 13 409 1 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain N315)
P60297 5.28e-39 147 29 13 409 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHC8 5.28e-39 147 29 13 409 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain COL)
Q54JP5 6.42e-39 148 28 13 406 3 oatA Probable ornithine aminotransferase Dictyostelium discoideum
Q88RB9 6.49e-39 148 31 12 361 1 davT 5-aminovalerate aminotransferase DavT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q07907 7.16e-39 147 30 14 411 3 argD Acetylornithine aminotransferase Geobacillus stearothermophilus
Q7RT90 7.21e-39 147 28 17 425 1 OAT Ornithine aminotransferase Plasmodium yoelii yoelii
P59319 1.13e-38 147 33 10 343 3 argD Acetylornithine aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q07805 1.37e-38 147 28 17 427 2 OAT Ornithine aminotransferase Plasmodium falciparum (isolate CDC / Honduras)
Q6LFH8 1.37e-38 147 28 17 427 1 OAT Ornithine aminotransferase Plasmodium falciparum (isolate 3D7)
Q6GID1 1.44e-38 146 29 13 409 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MRSA252)
Q01K11 1.48e-38 149 27 14 453 3 OsI_17385 Gamma-aminobutyrate transaminase 1, mitochondrial Oryza sativa subsp. indica
Q10G56 1.68e-38 148 28 14 424 2 OAT Ornithine aminotransferase, mitochondrial Oryza sativa subsp. japonica
Q9KNW2 2.31e-38 146 31 10 338 3 argD Acetylornithine aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A1JS45 2.69e-38 146 33 10 333 3 astC Succinylornithine transaminase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q8PX16 3.01e-38 145 29 17 422 3 argD Acetylornithine aminotransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B4T3Z4 3.93e-38 145 33 12 339 3 astC Succinylornithine transaminase Salmonella newport (strain SL254)
P73133 4.1e-38 146 29 20 457 1 argD Acetylornithine aminotransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P63567 5.33e-38 145 34 9 318 3 argD Acetylornithine aminotransferase Brucella suis biovar 1 (strain 1330)
P63566 5.33e-38 145 34 9 318 3 argD Acetylornithine aminotransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7XN11 7.07e-38 147 27 14 453 1 OSL2 Gamma-aminobutyrate transaminase 1, mitochondrial Oryza sativa subsp. japonica
O53379 8.8e-38 145 29 10 419 1 Rv3329 Probable aminotransferase Rv3329 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
O04866 9.58e-38 145 30 14 399 2 AG118 Acetylornithine aminotransferase, mitochondrial Alnus glutinosa
B5BA72 1.06e-37 144 33 12 339 3 astC Succinylornithine transaminase Salmonella paratyphi A (strain AKU_12601)
Q5PHC8 1.06e-37 144 33 12 339 3 astC Succinylornithine transaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9PIR7 1.29e-37 144 26 12 416 1 argD Acetylornithine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q7MH19 1.46e-37 144 31 10 338 3 argD Acetylornithine aminotransferase Vibrio vulnificus (strain YJ016)
P59323 1.49e-37 144 31 10 338 3 argD Acetylornithine aminotransferase Vibrio vulnificus (strain CMCP6)
Q7WKW5 1.6e-37 144 31 13 376 3 argD1 Acetylornithine aminotransferase 1 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7N9E5 1.85e-37 144 34 11 313 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8CT82 2.01e-37 143 28 13 414 3 rocD Ornithine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q92SA0 2.17e-37 143 32 15 399 3 argD Acetylornithine aminotransferase Rhizobium meliloti (strain 1021)
Q8ZPV2 2.2e-37 144 33 12 339 2 astC Succinylornithine transaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q7W7H6 2.58e-37 143 30 12 380 3 argD1 Acetylornithine aminotransferase 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P04181 3.05e-37 144 29 17 435 1 OAT Ornithine aminotransferase, mitochondrial Homo sapiens
Q8TUZ5 3.15e-37 142 30 14 419 3 argD Acetylornithine aminotransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q84P53 3.22e-37 144 29 11 355 1 GABA-TP2 Gamma aminobutyrate transaminase 2 Solanum lycopersicum
A9N278 3.24e-37 143 35 12 310 3 astC Succinylornithine transaminase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P59086 3.37e-37 143 32 13 340 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6ZH29 4.11e-37 144 27 14 429 2 GABA-T Probable gamma-aminobutyrate transaminase 4 Oryza sativa subsp. japonica
B5RB01 4.13e-37 143 33 12 339 3 astC Succinylornithine transaminase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWJ0 4.13e-37 143 33 12 339 3 astC Succinylornithine transaminase Salmonella enteritidis PT4 (strain P125109)
Q49W96 4.32e-37 142 28 14 408 3 rocD2 Ornithine aminotransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P22256 4.32e-37 143 28 14 417 1 gabT 4-aminobutyrate aminotransferase GabT Escherichia coli (strain K12)
Q8CUM9 4.43e-37 142 29 15 410 3 argD Acetylornithine aminotransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B5F846 5.78e-37 142 33 12 339 3 astC Succinylornithine transaminase Salmonella agona (strain SL483)
Q7VTJ7 6.52e-37 142 31 13 376 3 argD1 Acetylornithine aminotransferase 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q57PX9 7.93e-37 142 34 11 306 3 astC Succinylornithine transaminase Salmonella choleraesuis (strain SC-B67)
P29758 8.06e-37 142 28 15 407 1 Oat Ornithine aminotransferase, mitochondrial Mus musculus
C0Q6X9 8.17e-37 142 34 12 310 3 astC Succinylornithine transaminase Salmonella paratyphi C (strain RKS4594)
B4TGE0 8.17e-37 142 34 12 310 3 astC Succinylornithine transaminase Salmonella heidelberg (strain SL476)
B5FJD8 8.17e-37 142 34 12 310 3 astC Succinylornithine transaminase Salmonella dublin (strain CT_02021853)
P18335 1.03e-36 142 34 13 329 1 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli (strain K12)
B9EAM9 1.17e-36 141 29 15 405 3 rocD Ornithine aminotransferase Macrococcus caseolyticus (strain JCSC5402)
Q7XN12 1.2e-36 143 27 15 443 2 Os04g0614500 Probable gamma-aminobutyrate transaminase 2, mitochondrial Oryza sativa subsp. japonica
Q01K12 1.2e-36 143 27 15 443 3 OsI_17384 Probable gamma-aminobutyrate transaminase 2, mitochondrial Oryza sativa subsp. indica
Q8Z6F9 1.2e-36 141 34 12 310 3 astC Succinylornithine transaminase Salmonella typhi
Q1RB45 1.35e-36 141 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain UTI89 / UPEC)
Q8FGZ9 1.35e-36 141 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH82 1.35e-36 141 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABS9 1.35e-36 141 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O1:K1 / APEC
B7MVM7 1.35e-36 141 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O81 (strain ED1a)
B7MAV9 1.35e-36 141 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O45:K1 (strain S88 / ExPEC)
P04182 1.76e-36 142 29 15 407 1 Oat Ornithine aminotransferase, mitochondrial Rattus norvegicus
Q9AAL3 1.77e-36 140 33 8 302 3 argD1 Acetylornithine aminotransferase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q8X4S6 2.27e-36 140 34 13 329 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli O157:H7
P59317 2.34e-36 140 32 13 350 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LQ44 2.61e-36 140 30 16 405 3 astC Succinylornithine transaminase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8TUE8 2.62e-36 140 29 17 417 3 argD Acetylornithine aminotransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
P59321 2.84e-36 140 32 14 375 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Shigella flexneri
Q7SI94 3.35e-36 140 30 13 398 3 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q5HQK4 3.66e-36 140 28 13 414 3 rocD Ornithine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q3Z295 4.04e-36 140 30 16 408 3 astC Succinylornithine transaminase Shigella sonnei (strain Ss046)
Q18040 4.83e-36 140 27 13 405 3 oatr-1 Probable ornithine aminotransferase, mitochondrial Caenorhabditis elegans
Q9K8V5 6.74e-36 139 28 13 409 3 argD Acetylornithine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q89VE9 8e-36 139 29 11 393 3 argD1 Acetylornithine aminotransferase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B7N584 8.39e-36 139 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B9DIU0 8.68e-36 139 27 12 404 3 rocD Ornithine aminotransferase Staphylococcus carnosus (strain TM300)
Q4A0N2 9.95e-36 139 28 11 421 3 rocD1 Ornithine aminotransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A8A0U0 1.31e-35 139 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O9:H4 (strain HS)
B7USC9 1.54e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q53196 1.55e-35 139 25 13 454 3 NGR_a01380 Uncharacterized aminotransferase y4uB Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B6IBG8 1.93e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain SE11)
P77581 1.93e-35 138 30 16 408 1 astC Succinylornithine transaminase Escherichia coli (strain K12)
B1IPI2 1.93e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XGK9 1.93e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain K12 / DH10B)
C4ZZA4 1.93e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1G0 1.93e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O8 (strain IAI1)
A7ZML6 1.93e-35 138 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q9M8M7 2.24e-35 139 28 13 401 1 WIN1 Acetylornithine aminotransferase, chloroplastic/mitochondrial Arabidopsis thaliana
B5YQ35 2.31e-35 138 30 16 405 3 astC Succinylornithine transaminase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X598 2.31e-35 138 30 16 405 3 astC Succinylornithine transaminase Escherichia coli O157:H7
Q321P0 2.56e-35 138 30 16 408 3 astC Succinylornithine transaminase Shigella boydii serotype 4 (strain Sb227)
B2U3D0 2.56e-35 138 30 16 408 3 astC Succinylornithine transaminase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q4JAP8 2.57e-35 137 28 11 380 1 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q9VW26 2.82e-35 138 28 12 404 2 Oat Ornithine aminotransferase, mitochondrial Drosophila melanogaster
P07991 3.47e-35 138 29 12 410 1 CAR2 Ornithine aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O34662 3.49e-35 138 27 11 435 3 yodT Uncharacterized aminotransferase YodT Bacillus subtilis (strain 168)
B1LDY3 3.57e-35 137 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain SMS-3-5 / SECEC)
B7NT29 4.33e-35 137 30 16 408 3 astC Succinylornithine transaminase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q9JTX9 8.74e-35 136 33 8 317 3 argD Acetylornithine aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P49724 1.2e-34 136 27 15 434 1 Oat Ornithine aminotransferase, mitochondrial Drosophila ananassae
A8AHE0 1.38e-34 136 30 16 417 3 astC Succinylornithine transaminase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9X2A5 1.39e-34 135 28 10 393 1 argD Acetylornithine aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B7L6M2 1.49e-34 135 30 16 408 3 astC Succinylornithine transaminase Escherichia coli (strain 55989 / EAEC)
Q9JYY4 1.73e-34 135 33 8 316 3 argD Acetylornithine aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
O58478 3.32e-34 136 29 14 420 1 PH0782 Alanine/serine racemase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B9ITF9 4.07e-34 134 29 13 409 3 rocD Ornithine aminotransferase Bacillus cereus (strain Q1)
A0QYS9 4.87e-34 134 29 14 416 1 argD Acetylornithine aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P50457 1.02e-33 134 28 11 397 1 puuE 4-aminobutyrate aminotransferase PuuE Escherichia coli (strain K12)
Q7N2G7 1.15e-33 133 33 11 298 3 astC Succinylornithine transaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q3ZCF5 1.34e-33 134 29 16 408 2 OAT Ornithine aminotransferase, mitochondrial Bos taurus
Q9APM5 1.43e-33 134 27 15 444 1 tpa Taurine--pyruvate aminotransferase Bilophila wadsworthia
E5Y945 1.43e-33 134 27 15 444 1 tpa Taurine--pyruvate aminotransferase Bilophila wadsworthia (strain 3_1_6)
O27392 1.45e-33 133 30 18 421 3 argD Acetylornithine aminotransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q94CE5 1.73e-33 134 26 13 437 1 POP2 Gamma-aminobutyrate transaminase POP2, mitochondrial Arabidopsis thaliana
O30156 1.87e-33 132 29 14 410 3 argD Acetylornithine aminotransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q7VSA0 2.09e-33 132 30 15 399 3 rocD Ornithine aminotransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1E4 2.09e-33 132 30 15 399 3 rocD Ornithine aminotransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WP51 2.09e-33 132 30 15 399 3 rocD Ornithine aminotransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
C1EL61 2.77e-33 132 29 13 409 3 rocD Ornithine aminotransferase Bacillus cereus (strain 03BB102)
P38021 3.17e-33 132 29 15 403 1 rocD Ornithine aminotransferase Bacillus subtilis (strain 168)
Q81TV3 3.32e-33 132 29 13 409 1 rocD Ornithine aminotransferase Bacillus anthracis
C3LBX0 3.32e-33 132 29 13 409 3 rocD Ornithine aminotransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3K3 3.32e-33 132 29 13 409 3 rocD Ornithine aminotransferase Bacillus anthracis (strain A0248)
P54752 4.85e-33 132 26 15 441 3 argD Acetylornithine aminotransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P59320 5.71e-33 131 32 12 340 3 argD Acetylornithine aminotransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q89RB7 1.02e-32 130 28 15 383 3 rocD Ornithine aminotransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O57878 1.1e-32 132 26 14 454 1 PH0138 Broad substrate specificity amino-acid racemase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O82521 1.19e-32 131 25 13 424 1 VAMT Vanillin aminotransferase Capsicum chinense
P40829 2.48e-32 130 29 15 421 3 gabT 4-aminobutyrate aminotransferase Mycobacterium leprae (strain TN)
Q89LG2 2.49e-32 129 32 9 322 3 argD2 Acetylornithine aminotransferase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q976K0 3.49e-32 129 29 13 364 3 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q81GP2 3.67e-32 129 28 13 409 3 rocD Ornithine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P59316 3.72e-32 129 26 16 413 3 argD Acetylornithine aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
C4L2E7 3.76e-32 129 29 17 417 3 rocD Ornithine aminotransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q882K8 3.88e-32 129 29 15 408 3 argD2 Acetylornithine aminotransferase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
D6R3B6 3.98e-32 130 25 13 424 1 PAMT Vanillin aminotransferase Capsicum frutescens
Q30WH2 7.3e-32 129 31 17 388 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
E1AQY3 7.42e-32 129 25 13 424 2 VAMT Vanillin aminotransferase Capsicum annuum
Q9K5Z2 7.8e-32 128 27 15 406 3 rocD Ornithine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7VAS9 8.69e-32 128 26 15 404 3 argD Acetylornithine aminotransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q82UP3 9.42e-32 128 31 12 321 3 argD Acetylornithine aminotransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P59315 9.47e-32 129 27 11 401 3 argD Acetylornithine aminotransferase Bifidobacterium longum (strain NCC 2705)
Q87DM8 1.41e-31 127 34 12 332 3 argD Acetylornithine aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0F481 1.63e-31 130 26 14 425 1 BIO3-BIO1 Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial Arabidopsis thaliana
Q5W267 1.66e-31 130 31 10 325 1 pigE Aminotransferase PigE Serratia sp. (strain ATCC 39006)
Q9CHD3 2.02e-31 126 30 16 382 3 argD Acetylornithine aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
C0ZBR4 2.05e-31 127 30 9 309 3 rocD Ornithine aminotransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P94427 3.28e-31 127 27 9 351 3 gabT Probable 4-aminobutyrate aminotransferase Bacillus subtilis (strain 168)
A0A098DDI1 4.57e-31 128 29 9 330 3 FGRAMPH1_01T09365 Aminotransferase FGSG_17085 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q7NN66 6e-31 125 30 14 421 3 argD Acetylornithine aminotransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
C5D6R2 7.69e-31 125 26 13 404 3 rocD Ornithine aminotransferase Geobacillus sp. (strain WCH70)
Q8P5Q4 8.97e-31 125 33 13 364 3 argD Acetylornithine aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
H3ZR39 9.23e-31 126 29 17 415 1 OCC_10945 Leucine/methionine racemase Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q71Z79 1.01e-30 125 28 16 409 3 argD Acetylornithine aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
P59322 1.6e-30 125 28 15 408 3 argD Acetylornithine aminotransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q8XWN8 2.27e-30 124 29 15 399 3 argD Acetylornithine aminotransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q5JEW1 5.06e-30 124 28 20 427 1 TK2101 Ornithine aminotransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P36839 5.29e-30 123 29 15 399 3 argD Acetylornithine aminotransferase Bacillus subtilis (strain 168)
Q9CC12 7.75e-30 122 26 13 410 3 argD Acetylornithine aminotransferase Mycobacterium leprae (strain TN)
E1V7V7 1.26e-29 123 26 9 365 3 doeD Diaminobutyrate--2-oxoglutarate transaminase Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
Q9US34 1.29e-29 123 26 12 415 3 SPAC1039.07c Uncharacterized aminotransferase C1039.07c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8U0B4 1.35e-29 121 28 16 397 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9PDF2 1.57e-29 122 34 12 332 3 argD Acetylornithine aminotransferase Xylella fastidiosa (strain 9a5c)
Q6BUP9 1.59e-29 123 26 11 359 3 ARG8 Acetylornithine aminotransferase, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
A1B9Z3 1.77e-29 122 26 19 463 1 hpa/tpa Hypotaurine/taurine--pyruvate aminotransferase Paracoccus denitrificans (strain Pd 1222)
Q7V8L1 1.99e-29 122 28 17 427 3 argD Acetylornithine aminotransferase Prochlorococcus marinus (strain MIT 9313)
Q9CNT1 2.6e-29 121 32 9 275 3 argD Acetylornithine aminotransferase Pasteurella multocida (strain Pm70)
Q9V1I4 3.05e-29 120 29 16 397 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus abyssi (strain GE5 / Orsay)
P9WPZ7 3.75e-29 120 28 13 415 1 argD Acetylornithine aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPZ6 3.75e-29 120 28 13 415 3 argD Acetylornithine aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63569 3.75e-29 120 28 13 415 3 argD Acetylornithine aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9A652 4.32e-29 120 31 15 398 3 argD2 Acetylornithine aminotransferase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
O59401 4.69e-29 120 28 13 396 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8ZV07 5.58e-29 120 27 10 381 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q5YW77 6e-29 120 28 16 425 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Nocardia farcinica (strain IFM 10152)
P30900 6.83e-29 120 31 12 312 3 argD Acetylornithine aminotransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8PH31 8.57e-29 120 32 13 364 3 argD Acetylornithine aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q8CSG1 1.16e-28 119 30 13 313 3 argD Acetylornithine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q55DT8 1.42e-28 120 28 14 359 3 argD Probable acetylornithine aminotransferase, mitochondrial Dictyostelium discoideum
Q9YBY6 1.85e-28 119 27 10 383 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q6ZKV8 2.01e-28 121 25 11 428 2 BIO3-BIO1 Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial Oryza sativa subsp. japonica
Q6QUY9 2.24e-28 119 28 12 392 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces anulatus
Q6C846 3.55e-28 118 28 10 345 3 ARG8 Acetylornithine aminotransferase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
A6VQ66 4.2e-28 118 29 17 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A0A0J9X1Q5 5.55e-28 120 31 10 329 1 pigE Aminotransferase PigE Serratia sp. (strain FS14)
Q818W2 7.67e-28 117 27 14 413 3 argD Acetylornithine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7U5R5 7.79e-28 117 29 16 406 3 argD Acetylornithine aminotransferase Parasynechococcus marenigrum (strain WH8102)
Q5WL78 8e-28 117 31 13 314 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Shouchella clausii (strain KSM-K16)
B1KHF6 8.61e-28 117 30 13 330 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella woodyi (strain ATCC 51908 / MS32)
A3QBN5 8.86e-28 117 30 13 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7V0G0 9.8e-28 117 24 14 392 3 argD Acetylornithine aminotransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q9AP34 1.03e-27 117 30 14 338 2 ectB Diaminobutyrate--2-oxoglutarate transaminase Sporosarcina pasteurii
Q5JGG6 1.3e-27 117 29 16 422 1 TK1211 Leucine/methionine racemase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q59928 1.49e-27 116 27 14 390 3 argD Acetylornithine aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5HP24 1.57e-27 115 30 13 313 3 argD Acetylornithine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8Y6U4 1.62e-27 116 27 16 409 3 argD Acetylornithine aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q829L4 2.37e-27 116 27 18 410 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
M1GRN3 2.97e-27 116 26 14 415 1 None Isoleucine 2-epimerase Lentilactobacillus buchneri
O06060 3.03e-27 115 27 19 425 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Marinococcus halophilus
Q9KED4 3.68e-27 115 31 12 313 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O50131 3.68e-27 116 29 13 367 1 PH1423 Ornithine aminotransferase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B1ZVF7 5.57e-27 115 31 13 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
O74548 6.26e-27 115 29 17 389 2 arg1 Probable acetylornithine aminotransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A8FS76 7.08e-27 115 27 15 400 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sediminis (strain HAW-EB3)
Q5AYI6 7.22e-27 117 27 9 353 1 bioDA Bifunctional dethiobiotin synthetase/adenosylmethionine-8-amino-7-oxononanoate aminotransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q7W979 7.31e-27 115 28 19 435 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHI8 7.31e-27 115 28 19 435 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P16932 1.06e-26 114 26 16 448 1 dgdA 2,2-dialkylglycine decarboxylase Burkholderia cepacia
A1S3U0 1.14e-26 114 29 13 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q93RW1 1.17e-26 114 27 17 410 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8D3C8 1.3e-26 114 28 15 342 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Wigglesworthia glossinidia brevipalpis
Q9L1A4 1.39e-26 114 30 12 369 3 argD Acetylornithine aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B6HZD0 1.45e-26 114 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain SE11)
B7N823 1.45e-26 114 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A7ZWA2 1.45e-26 114 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O9:H4 (strain HS)
Q6PR32 1.53e-26 114 27 14 404 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Virgibacillus pantothenticus
Q92BC0 1.56e-26 113 27 15 417 3 argD Acetylornithine aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q81M98 1.64e-26 113 27 15 418 3 argD Acetylornithine aminotransferase Bacillus anthracis
P44951 1.85e-26 114 30 12 346 1 dat Diaminobutyrate--2-oxoglutarate aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q325Y5 2e-26 113 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella boydii serotype 4 (strain Sb227)
B2U2Z9 2e-26 113 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
D5AKY0 2.27e-26 114 28 19 444 2 tpa Taurine--pyruvate aminotransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
B1LGV7 2.6e-26 113 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain SMS-3-5 / SECEC)
A6T4V8 2.72e-26 113 29 12 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P59318 2.74e-26 112 27 14 407 3 argD Acetylornithine aminotransferase Myxococcus xanthus
P23893 3.31e-26 113 28 16 389 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain K12)
B1XD24 3.31e-26 113 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain K12 / DH10B)
C4ZRP7 3.31e-26 113 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain K12 / MC4100 / BW2952)
B1IQI6 3.37e-26 113 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M195 3.37e-26 113 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O8 (strain IAI1)
B7LGL6 3.37e-26 113 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain 55989 / EAEC)
A7ZHP6 3.37e-26 113 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z5K3 3.44e-26 113 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella sonnei (strain Ss046)
Q88FI7 3.51e-26 112 28 16 419 1 PP_4108 2-aminoadipate transaminase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q32JV4 4.22e-26 112 28 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella dysenteriae serotype 1 (strain Sd197)
B2VE25 4.38e-26 112 29 13 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5Z0D4 4.56e-26 112 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4V5 4.56e-26 112 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O157:H7
Q5WWG1 4.76e-26 112 30 13 327 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Lens)
B8CJG4 5.61e-26 112 28 13 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella piezotolerans (strain WP3 / JCM 13877)
B5Y1L5 6.15e-26 112 28 12 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Klebsiella pneumoniae (strain 342)
Q5JFW3 8.5e-26 110 29 18 408 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
B0U0T6 8.63e-26 112 27 13 343 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A8ALD5 8.72e-26 112 28 17 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q1RG34 9.43e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain UTI89 / UPEC)
Q8FL16 9.43e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH7 9.43e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K0 9.43e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O1:K1 / APEC
B7MBD7 9.43e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK1 9.43e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7MP16 9.99e-26 111 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O81 (strain ED1a)
Q725I1 1.71e-25 110 30 12 334 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1V9X6 1.76e-25 110 30 12 334 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitratidesulfovibrio vulgaris (strain DP4)
Q821C1 1.8e-25 110 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella flexneri
Q0T852 1.8e-25 110 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella flexneri serotype 5b (strain 8401)
P0CL07 1.8e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1W874 1.8e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella typhimurium (strain SL1344)
B7NIB7 1.95e-25 110 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B3GYN8 1.99e-25 110 28 18 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9CNG9 2.11e-25 110 28 18 421 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pasteurella multocida (strain Pm70)
B1X023 2.25e-25 110 28 13 376 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Crocosphaera subtropica (strain ATCC 51142 / BH68)
B0BRF0 2.27e-25 110 28 18 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q828A3 2.33e-25 110 26 13 417 3 argD Acetylornithine aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A3N2K3 2.41e-25 110 28 18 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7MGR5 2.6e-25 110 28 12 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Cronobacter sakazakii (strain ATCC BAA-894)
A8H164 2.64e-25 110 27 17 400 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q75AW1 3.02e-25 110 27 14 376 3 ARG8 Acetylornithine aminotransferase, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
A9N0P9 3.1e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B2J7M9 3.11e-25 110 28 14 378 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B4TXQ6 3.25e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella schwarzengrund (strain CVM19633)
B5FJ01 3.25e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella dublin (strain CT_02021853)
Q8Z9B4 3.31e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella typhi
B5BL82 3.41e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi A (strain AKU_12601)
Q5PD43 3.41e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TK30 3.48e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella heidelberg (strain SL476)
B5R3G6 3.48e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella enteritidis PT4 (strain P125109)
Q2NVQ0 3.61e-25 110 31 11 298 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Sodalis glossinidius (strain morsitans)
B7LWB5 3.68e-25 110 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B4SUY4 3.72e-25 110 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella newport (strain SL254)
P55628 3.91e-25 110 29 13 344 3 NGR_a01910 Uncharacterized aminotransferase y4qG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A5IC29 3.99e-25 110 31 14 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Corby)
B0TIQ0 5.03e-25 109 26 15 400 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella halifaxensis (strain HAW-EB4)
B5RHE0 5.47e-25 109 29 12 330 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A3DIF3 6.39e-25 109 28 20 421 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
C0Q5R5 6.76e-25 109 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi C (strain RKS4594)
Q57T53 6.76e-25 109 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella choleraesuis (strain SC-B67)
A0KNY9 7.18e-25 109 29 17 386 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4TPW6 8.77e-25 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis (strain Pestoides F)
Q1CLU7 8.77e-25 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E6 8.77e-25 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBL9 8.77e-25 108 30 13 311 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis
Q1C3X1 8.77e-25 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis bv. Antiqua (strain Antiqua)
A4SJ79 8.87e-25 108 28 17 386 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Aeromonas salmonicida (strain A449)
Q5ZVA6 1.01e-24 108 30 14 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X529 1.09e-24 108 30 14 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Paris)
A9MPK7 1.1e-24 108 27 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B1JK22 1.13e-24 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EF1 1.13e-24 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K547 1.13e-24 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FM09 1.13e-24 108 30 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8PW58 1.23e-24 108 27 14 385 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
B5F8R5 1.34e-24 108 28 12 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella agona (strain SL483)
B1I4L1 1.38e-24 108 30 12 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulforudis audaxviator (strain MP104C)
Q8TT57 1.49e-24 108 26 15 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q47V96 1.64e-24 108 27 19 398 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q65U43 1.66e-24 108 28 14 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q10174 1.9e-24 108 28 10 296 3 SPAC27F1.05c Uncharacterized aminotransferase C27F1.05c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B1XIT5 2.13e-24 107 27 13 368 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A9L5J5 2.26e-24 107 27 14 368 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS195)
Q8EHC8 2.37e-24 107 28 12 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HSE6 2.58e-24 107 28 12 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain MR-7)
Q0I3R7 2.76e-24 107 27 13 342 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Histophilus somni (strain 129Pt)
C4LAK4 2.81e-24 107 29 12 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C6DC32 2.89e-24 107 29 12 327 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BAP9 2.89e-24 107 26 14 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Edwardsiella ictaluri (strain 93-146)
A1RMG7 3.07e-24 107 28 12 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain W3-18-1)
A4Y4G4 3.07e-24 107 28 12 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KSC7 3.47e-24 107 31 12 308 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
O52250 3.52e-24 107 31 9 266 1 ectB Diaminobutyrate--2-oxoglutarate transaminase Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
Q7MAE6 3.53e-24 106 29 14 330 3 argD Acetylornithine aminotransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B4EUE1 3.71e-24 107 28 12 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Proteus mirabilis (strain HI4320)
B2UNE3 4.2e-24 107 29 13 331 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q2S1S3 4.5e-24 107 32 13 298 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salinibacter ruber (strain DSM 13855 / M31)
Q9ZEU7 4.53e-24 107 30 10 318 1 ectB Diaminobutyrate--2-oxoglutarate transaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B0UST3 4.59e-24 107 27 13 342 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Histophilus somni (strain 2336)
P56744 4.63e-24 107 28 12 331 1 dat Diaminobutyrate--2-oxoglutarate aminotransferase Acinetobacter baumannii
B7K2I1 5.15e-24 107 28 16 405 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q7NPI4 5.45e-24 106 29 16 384 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A6WKL6 6.41e-24 106 26 16 400 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS185)
B8EBU3 6.41e-24 106 26 16 400 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS223)
P18544 6.71e-24 106 24 13 399 1 ARG8 Acetylornithine aminotransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A3D1R5 7.69e-24 106 25 14 396 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A0LIP3 7.84e-24 106 30 11 306 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q6D1Z0 8.14e-24 106 29 12 327 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A5UU40 8.79e-24 106 30 12 334 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Roseiflexus sp. (strain RS-1)
A6LKX4 8.95e-24 105 26 16 389 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q8ESU8 9.76e-24 105 28 12 337 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q1LQM3 9.87e-24 105 29 17 415 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3IHS1 1.03e-23 105 27 13 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pseudoalteromonas translucida (strain TAC 125)
O14433 1.05e-23 105 25 16 425 3 ARG8 Acetylornithine aminotransferase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q5QVP9 1.14e-23 105 29 17 364 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8G9U7 1.18e-23 105 30 12 303 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Serratia proteamaculans (strain 568)
A7NKV1 1.31e-23 105 32 11 298 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q2RJ31 1.44e-23 105 30 13 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B0CC57 1.56e-23 105 28 13 376 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acaryochloris marina (strain MBIC 11017)
A0KZS6 1.67e-23 105 28 12 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain ANA-3)
A4W6Q1 1.85e-23 105 28 12 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Enterobacter sp. (strain 638)
Q0HG53 1.91e-23 105 28 12 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain MR-4)
B5ERN9 1.93e-23 105 29 14 360 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBI1 1.93e-23 105 29 14 360 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q2JS70 2.24e-23 105 28 14 383 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain JA-3-3Ab)
Q87NZ7 2.71e-23 104 30 11 315 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B1YJU8 2.74e-23 104 30 10 298 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q07YU5 2.79e-23 104 28 13 339 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella frigidimarina (strain NCIMB 400)
A1JJQ1 2.85e-23 104 29 13 311 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9Z3R2 2.99e-23 105 25 13 451 3 rhbA Diaminobutyrate--2-oxoglutarate aminotransferase Rhizobium meliloti (strain 1021)
Q5P6J6 2.99e-23 104 30 14 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q82E21 3.04e-23 104 29 11 353 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A4SGT2 3.13e-23 104 29 13 312 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q7N845 3.16e-23 104 28 12 326 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0KDN9 3.29e-23 104 29 16 392 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8KAQ7 3.55e-23 104 29 12 312 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q976H2 3.72e-23 104 27 11 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
B3QSA6 3.86e-23 104 30 14 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3B1A1 4.01e-23 104 29 13 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q2JMP7 4.08e-23 104 28 14 383 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain JA-2-3B'a(2-13))
C3LSN1 4.33e-23 104 29 14 342 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Vibrio cholerae serotype O1 (strain M66-2)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_04425
Feature type CDS
Gene bioA
Product adenosylmethionine--8-amino-7-oxononanoate transaminase
Location 215420 - 216721 (strand: 1)
Length 1302 (nucleotides) / 433 (amino acids)

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1491
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00202 Aminotransferase class-III

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0161 Coenzyme transport and metabolism (H) H Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MTFSGNISGHAFSADDADFDLRHIWHPYTSMTQPLPVYPVVSARGAVLTLADGRELVDGMSSWWAAIHGYNHPVLNAAVTEQLSQMSHVMFGGITHPAAVALCRRLVDITPEPLECVFPADSGSVAVEVALKMALQYWQARGEKRHRIITPRHGYHGDTFGAMSVCDPQNSMHSLWQGYLPDHLFADAPQCGFDEEWRPEDLHSVENLLAQHHHEVAAVILEPVVQGAGGMRFYHPEYLKGVRSLCDHYNVLLICDEIATGFGRTGKLFACEHAGISPDIMCLGKAITGGYMTLSATLTTRHIADTISQGDAGCFMHGPTFMGNPLACATAVASIDLLLSGDWAARVKAIETQLKSALLPLKSRSGVRDARVLGTIGVIETEEPVNMAELQRRFVDAGVWIRPFGRLIYIMPPYIITGAQLEKLTQAIDKVTA

Flanking regions ( +/- flanking 50bp)

AATATCAGCATTATCATGTCAACTTTATTTGCATTGAAATGGTTTACATAATGACTTTTTCAGGGAATATTTCAGGTCACGCCTTTTCGGCTGATGATGCGGATTTTGACCTCCGCCATATCTGGCACCCTTATACATCAATGACTCAGCCGCTGCCGGTCTATCCGGTGGTATCGGCACGCGGTGCGGTACTGACACTCGCAGACGGCCGCGAACTGGTTGACGGTATGTCCTCCTGGTGGGCGGCTATCCACGGCTATAATCACCCGGTACTGAATGCGGCGGTGACTGAACAGCTGTCACAGATGTCACATGTGATGTTCGGCGGGATCACCCATCCGGCTGCCGTTGCACTGTGCCGCCGCCTGGTGGATATCACACCTGAGCCGCTGGAATGCGTGTTTCCTGCCGACTCCGGCTCTGTCGCGGTAGAGGTGGCGCTGAAAATGGCGCTACAGTACTGGCAGGCACGCGGCGAAAAACGCCACCGGATAATCACACCGCGTCACGGCTACCACGGCGATACATTCGGCGCGATGTCAGTGTGTGATCCGCAAAACTCCATGCACTCACTCTGGCAGGGCTATCTGCCGGATCACCTGTTTGCTGATGCACCGCAGTGCGGATTTGATGAGGAATGGCGGCCGGAGGATCTTCATTCTGTGGAAAACCTGCTGGCACAGCATCATCACGAGGTCGCAGCCGTGATCCTGGAGCCGGTTGTCCAGGGTGCGGGCGGGATGCGCTTTTACCATCCGGAATATCTGAAAGGTGTAAGATCACTGTGTGATCACTACAATGTCCTGCTGATTTGTGACGAGATCGCGACCGGATTCGGACGCACCGGAAAGTTGTTTGCCTGTGAACACGCCGGTATATCACCAGACATTATGTGTCTCGGAAAAGCCATCACCGGCGGTTATATGACACTCTCCGCCACCCTCACCACCCGCCATATTGCAGACACCATCAGTCAGGGTGACGCAGGCTGCTTTATGCACGGTCCGACCTTTATGGGTAATCCGCTGGCCTGTGCCACCGCCGTGGCGAGTATTGATCTGCTGTTGTCCGGAGACTGGGCTGCGCGTGTGAAGGCCATCGAAACACAACTGAAAAGCGCCCTGCTGCCGCTGAAATCCCGCAGCGGAGTCCGCGATGCGCGGGTACTCGGCACCATTGGTGTGATTGAAACGGAAGAGCCGGTCAATATGGCAGAATTACAGCGCCGCTTTGTTGACGCCGGTGTGTGGATCCGCCCGTTCGGGCGGCTGATTTATATTATGCCGCCATACATTATTACCGGGGCACAGCTGGAAAAACTGACGCAGGCGATAGATAAGGTAACGGCATAAATCCCGGCATATTTGATCACTCCGCCGTTCAGGTTAACAGCGGGTAACGG