Homologs in group_1538

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09625 FBDBKF_09625 84.1 Morganella morganii S1 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
EHELCC_04425 EHELCC_04425 84.1 Morganella morganii S2 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
NLDBIP_04425 NLDBIP_04425 84.1 Morganella morganii S4 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
LHKJJB_14205 LHKJJB_14205 84.1 Morganella morganii S3 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
HKOGLL_12330 HKOGLL_12330 84.1 Morganella morganii S5 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase
PMI_RS02965 PMI_RS02965 73.0 Proteus mirabilis HI4320 bioA adenosylmethionine--8-amino-7-oxononanoate transaminase

Distribution of the homologs in the orthogroup group_1538

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1538

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P12677 0.0 637 71 0 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P53656 0.0 632 70 0 416 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Pseudescherichia vulneris
P12995 0.0 625 70 0 417 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Escherichia coli (strain K12)
P36568 0.0 605 70 1 415 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Serratia marcescens
P57379 0.0 568 61 0 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q5LEY1 0.0 551 61 1 424 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
E1WTS4 0.0 550 61 1 424 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain 638R)
Q64VX4 0.0 549 61 1 424 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides fragilis (strain YCH46)
Q8A7T2 0.0 537 58 1 427 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
E6SRG2 0.0 531 57 2 429 3 bioB Biotin biosynthesis bifunctional protein BioAB Bacteroides helcogenes (strain ATCC 35417 / DSM 20613 / JCM 6297 / CCUG 15421 / P 36-108)
Q89AK4 0.0 526 57 0 416 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P44426 0.0 514 58 1 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9P0 1.94e-172 493 57 0 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9FCC2 6.49e-157 453 54 3 413 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P50277 3.25e-149 435 49 10 459 3 BIO3 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WQ81 3.94e-149 434 54 6 414 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ80 3.94e-149 434 54 6 414 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4X7 3.94e-149 434 54 6 414 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P45488 4.57e-148 431 53 6 417 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Mycobacterium leprae (strain TN)
P46395 5.29e-147 427 51 6 416 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
P22805 4.44e-94 293 36 9 430 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Lysinibacillus sphaericus
Q74CT9 7.35e-93 290 39 10 441 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q31SA6 1.26e-91 286 41 8 419 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q2FVJ6 4.75e-90 283 34 11 432 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
P53555 1.22e-87 276 37 9 439 1 bioK L-Lysine--8-amino-7-oxononanoate transaminase Bacillus subtilis (strain 168)
O66557 6.64e-87 275 36 8 438 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Aquifex aeolicus (strain VF5)
B7GHM5 9.57e-84 267 37 9 427 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q728P4 1.35e-81 264 38 9 435 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q58696 2.17e-77 251 34 10 442 1 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9ZKM5 4.83e-74 241 34 11 437 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Helicobacter pylori (strain J99 / ATCC 700824)
O25627 2.47e-72 237 34 9 427 3 bioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase Helicobacter pylori (strain ATCC 700392 / 26695)
Q9A3Q9 3.39e-57 197 31 14 444 1 aptA Omega-aminotransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B1LF65 8.33e-50 178 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q0TD34 8.33e-50 178 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A4WEQ6 1.49e-49 177 32 14 401 3 patA Putrescine aminotransferase Enterobacter sp. (strain 638)
A6TEB2 2.01e-49 177 32 13 398 3 patA Putrescine aminotransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7ND61 2.4e-49 177 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B5XTY7 2.53e-49 177 32 13 398 3 patA Putrescine aminotransferase Klebsiella pneumoniae (strain 342)
A8A4N0 3.49e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O9:H4 (strain HS)
P42588 4.03e-49 176 33 15 403 1 patA Putrescine aminotransferase Escherichia coli (strain K12)
B1XG77 4.03e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain K12 / DH10B)
C4ZQY9 4.03e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain K12 / MC4100 / BW2952)
A8APX8 4.08e-49 176 32 14 401 3 patA Putrescine aminotransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q31WW1 4.34e-49 176 33 15 403 3 patA Putrescine aminotransferase Shigella boydii serotype 4 (strain Sb227)
Q1R6Q7 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain UTI89 / UPEC)
B6I445 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain SE11)
A1AFZ3 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O1:K1 / APEC
B7N0M2 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O81 (strain ED1a)
B5YRB3 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAN1 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O157:H7
B7LH08 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain 55989 / EAEC)
B7MB08 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIY0 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRV6 5.39e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1IRP4 7.44e-49 176 33 15 403 3 patA Putrescine aminotransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q3YXH0 7.6e-49 176 32 13 401 3 patA Putrescine aminotransferase Shigella sonnei (strain Ss046)
Q8FDF5 1.07e-48 175 33 15 406 3 patA Putrescine aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LQF8 1.13e-48 175 33 15 403 3 patA Putrescine aminotransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NJT8 1.81e-48 174 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q83JJ8 1.85e-48 174 33 15 403 3 patA Putrescine aminotransferase Shigella flexneri
Q0T0J2 1.85e-48 174 33 15 403 3 patA Putrescine aminotransferase Shigella flexneri serotype 5b (strain 8401)
O94562 1.99e-48 174 30 12 450 3 SPBC1773.03c Uncharacterized aminotransferase C1771.03c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B7LZM2 2.14e-48 174 33 15 403 3 patA Putrescine aminotransferase Escherichia coli O8 (strain IAI1)
P33189 3.22e-47 171 29 13 441 3 yhxA Uncharacterized aminotransferase YhxA Bacillus subtilis (strain 168)
Q6D6Y6 7.83e-47 170 32 15 400 3 patA Putrescine aminotransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q9I6J2 1.95e-46 169 28 12 435 1 spuC Putrescine--pyruvate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8EP32 2.8e-46 167 30 15 404 3 rocD Ornithine aminotransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8UI71 4.53e-46 167 31 12 385 3 argD Acetylornithine aminotransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8ZLX7 5.46e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TVV2 5.46e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella schwarzengrund (strain CVM19633)
B4T688 5.46e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella newport (strain SL254)
B5F6B4 5.46e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella agona (strain SL483)
Q8Z3L9 5.81e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella typhi
B5BG29 5.81e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella paratyphi A (strain AKU_12601)
Q5PC95 5.81e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TIU6 5.81e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella heidelberg (strain SL476)
Q59282 5.87e-46 166 32 12 403 1 argD Acetylornithine aminotransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B5REH5 5.93e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ53 5.93e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella enteritidis PT4 (strain P125109)
B5FHV3 5.93e-46 168 35 10 307 3 patA Putrescine aminotransferase Salmonella dublin (strain CT_02021853)
A7MIU0 1.15e-45 167 36 10 310 3 patA Putrescine aminotransferase Cronobacter sakazakii (strain ATCC BAA-894)
C0PYZ1 2.31e-45 166 35 10 307 3 patA Putrescine aminotransferase Salmonella paratyphi C (strain RKS4594)
Q57JP1 2.31e-45 166 35 10 307 3 patA Putrescine aminotransferase Salmonella choleraesuis (strain SC-B67)
Q8FTN2 2.57e-45 165 31 9 395 3 argD Acetylornithine aminotransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A9N5Z8 4.03e-45 166 35 10 307 3 patA Putrescine aminotransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P28269 8.08e-45 164 30 10 430 1 None Omega-amino acid--pyruvate aminotransferase Pseudomonas putida
Q8PX16 9.65e-45 163 32 18 429 3 argD Acetylornithine aminotransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A9MPU4 9.77e-45 164 33 9 310 3 patA Putrescine aminotransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8NYM5 1.14e-44 163 31 13 411 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MW2)
Q6GCU1 1.14e-44 163 31 13 411 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MSSA476)
Q5HJI8 1.14e-44 163 31 13 411 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain COL)
P30268 1.42e-44 164 30 12 421 3 BpOF4_10225 Uncharacterized aminotransferase BpOF4_10225 Alkalihalophilus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4)
Q6GKC1 1.67e-44 162 31 13 411 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain MRSA252)
P60296 1.85e-44 162 31 13 411 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain N315)
P60295 1.85e-44 162 31 13 411 3 rocD1 Ornithine aminotransferase 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q9I700 7.03e-44 162 27 11 429 1 bauA Beta-alanine--pyruvate aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8R7C1 8.77e-44 160 29 15 422 3 argD Acetylornithine aminotransferase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q7VMS5 2.8e-43 159 30 12 423 3 argD Acetylornithine aminotransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P63567 3.18e-43 159 31 11 391 3 argD Acetylornithine aminotransferase Brucella suis biovar 1 (strain 1330)
P63566 3.18e-43 159 31 11 391 3 argD Acetylornithine aminotransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9I6M4 3.32e-43 160 31 14 406 1 davT 5-aminovalerate aminotransferase DavT Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q92413 4.79e-43 160 29 14 412 1 otaA Ornithine aminotransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q9RW75 7.77e-43 159 33 15 399 3 lysJ [LysW]-aminoadipate semialdehyde transaminase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9AAL3 7.78e-43 158 31 10 387 3 argD1 Acetylornithine aminotransferase 1 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P57600 9.01e-43 158 31 12 331 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q58131 1.75e-42 157 29 15 421 3 argD Acetylornithine aminotransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q84P54 3.47e-42 159 28 13 441 1 GABA-TP1 Gamma aminobutyrate transaminase 1, mitochondrial Solanum lycopersicum
B8BBZ7 4.78e-42 158 27 13 438 3 OsI_28220 Probable gamma-aminobutyrate transaminase 3, mitochondrial Oryza sativa subsp. indica
Q6ZCF0 4.92e-42 158 27 13 438 3 Os08g0205900 Probable gamma-aminobutyrate transaminase 3, mitochondrial Oryza sativa subsp. japonica
Q8TUE8 5.05e-42 155 31 15 436 3 argD Acetylornithine aminotransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
O30508 6.26e-42 155 33 13 363 1 aruC Succinylornithine transaminase/acetylornithine aminotransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P60299 6.28e-42 155 28 14 408 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MW2)
Q6GAW9 6.28e-42 155 28 14 408 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MSSA476)
P60298 6.28e-42 155 28 14 408 1 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain N315)
P60297 6.28e-42 155 28 14 408 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HHC8 6.28e-42 155 28 14 408 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain COL)
Q6GID1 6.82e-42 155 28 14 408 3 rocD2 Ornithine aminotransferase 2 Staphylococcus aureus (strain MRSA252)
Q97GH9 1.09e-41 155 31 14 390 3 argD Acetylornithine aminotransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q88RB9 1.4e-41 155 30 12 402 1 davT 5-aminovalerate aminotransferase DavT Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q10G56 1.53e-41 156 28 15 433 2 OAT Ornithine aminotransferase, mitochondrial Oryza sativa subsp. japonica
Q8TUZ5 1.97e-41 154 30 12 400 3 argD Acetylornithine aminotransferase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q84P52 2.74e-41 156 27 12 424 1 GABA-TP3 Gamma aminobutyrate transaminase 3, chloroplastic Solanum lycopersicum
P22256 2.96e-41 154 28 11 387 1 gabT 4-aminobutyrate aminotransferase GabT Escherichia coli (strain K12)
P04181 3.23e-41 154 29 15 427 1 OAT Ornithine aminotransferase, mitochondrial Homo sapiens
Q6CWC1 3.98e-41 154 29 15 431 1 CAR2 Ornithine aminotransferase Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q98BB7 5.03e-41 153 31 14 394 3 argD Acetylornithine aminotransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q92SA0 5.13e-41 153 32 17 404 3 argD Acetylornithine aminotransferase Rhizobium meliloti (strain 1021)
Q5SHH5 5.52e-41 153 31 11 394 1 lysJ [LysW]-aminoadipate semialdehyde transaminase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q07805 1.03e-40 152 28 15 402 2 OAT Ornithine aminotransferase Plasmodium falciparum (isolate CDC / Honduras)
Q6LFH8 1.03e-40 152 28 15 402 1 OAT Ornithine aminotransferase Plasmodium falciparum (isolate 3D7)
Q9KNW2 1.4e-40 152 31 9 346 3 argD Acetylornithine aminotransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7WDN7 2.02e-40 151 29 12 393 3 argD2 Acetylornithine aminotransferase 2 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W2N9 2.06e-40 151 29 12 393 3 argD2 Acetylornithine aminotransferase 2 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q93R93 2.19e-40 151 31 11 394 1 lysJ [LysW]-aminoadipate semialdehyde transaminase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q53196 3.7e-40 152 27 14 441 3 NGR_a01380 Uncharacterized aminotransferase y4uB Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q87L20 4.34e-40 150 30 16 411 3 argD Acetylornithine aminotransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B4T3Z4 4.73e-40 150 31 13 393 3 astC Succinylornithine transaminase Salmonella newport (strain SL254)
Q84P53 5.39e-40 152 28 9 350 1 GABA-TP2 Gamma aminobutyrate transaminase 2 Solanum lycopersicum
Q9PIR7 6.32e-40 150 27 12 414 1 argD Acetylornithine aminotransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9FNK4 6.78e-40 152 27 14 410 1 DELTA-OAT Ornithine aminotransferase, mitochondrial Arabidopsis thaliana
Q9P7L5 6.88e-40 151 30 14 409 2 car2 Ornithine aminotransferase car2 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B5BA72 7.9e-40 150 31 13 393 3 astC Succinylornithine transaminase Salmonella paratyphi A (strain AKU_12601)
Q5PHC8 7.9e-40 150 31 13 393 3 astC Succinylornithine transaminase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q885K0 1.21e-39 149 31 15 431 3 argD1 Acetylornithine aminotransferase 1 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P59324 1.23e-39 149 32 18 403 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Yersinia pestis
P29758 1.49e-39 150 29 17 433 1 Oat Ornithine aminotransferase, mitochondrial Mus musculus
Q8Z1Z3 1.68e-39 149 30 17 416 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Salmonella typhi
Q8ZPV2 1.74e-39 149 31 13 393 2 astC Succinylornithine transaminase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O53379 1.84e-39 150 28 10 420 1 Rv3329 Probable aminotransferase Rv3329 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q54JP5 2.13e-39 149 28 11 408 3 oatA Probable ornithine aminotransferase Dictyostelium discoideum
O04866 2.54e-39 150 30 15 401 2 AG118 Acetylornithine aminotransferase, mitochondrial Alnus glutinosa
P04182 3.43e-39 149 28 16 433 1 Oat Ornithine aminotransferase, mitochondrial Rattus norvegicus
Q7RT90 3.52e-39 149 28 17 424 1 OAT Ornithine aminotransferase Plasmodium yoelii yoelii
Q7VSH3 4.04e-39 148 29 12 393 3 argD2 Acetylornithine aminotransferase 2 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P59323 4.4e-39 148 31 10 334 3 argD Acetylornithine aminotransferase Vibrio vulnificus (strain CMCP6)
Q7MH19 4.49e-39 148 31 10 334 3 argD Acetylornithine aminotransferase Vibrio vulnificus (strain YJ016)
Q01K11 4.68e-39 150 26 15 456 3 OsI_17385 Gamma-aminobutyrate transaminase 1, mitochondrial Oryza sativa subsp. indica
B5F846 4.69e-39 148 31 13 393 3 astC Succinylornithine transaminase Salmonella agona (strain SL483)
A9N278 8.49e-39 147 31 13 393 3 astC Succinylornithine transaminase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
P40732 8.61e-39 147 30 17 416 1 argD Acetylornithine/succinyldiaminopimelate aminotransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5RB01 8.84e-39 147 31 13 393 3 astC Succinylornithine transaminase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWJ0 8.84e-39 147 31 13 393 3 astC Succinylornithine transaminase Salmonella enteritidis PT4 (strain P125109)
Q57PX9 9.59e-39 147 31 13 393 3 astC Succinylornithine transaminase Salmonella choleraesuis (strain SC-B67)
B5FJD8 9.79e-39 147 31 13 393 3 astC Succinylornithine transaminase Salmonella dublin (strain CT_02021853)
O66442 1.13e-38 146 28 14 391 1 argD Acetylornithine aminotransferase Aquifex aeolicus (strain VF5)
Q9K8V5 1.14e-38 146 29 13 400 3 argD Acetylornithine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C0Q6X9 1.24e-38 147 31 13 393 3 astC Succinylornithine transaminase Salmonella paratyphi C (strain RKS4594)
B4TGE0 1.24e-38 147 31 13 393 3 astC Succinylornithine transaminase Salmonella heidelberg (strain SL476)
Q4XWV5 1.33e-38 147 27 16 424 3 OAT Ornithine aminotransferase Plasmodium chabaudi chabaudi
Q7XN11 1.36e-38 149 26 13 442 1 OSL2 Gamma-aminobutyrate transaminase 1, mitochondrial Oryza sativa subsp. japonica
Q8Z6F9 1.41e-38 147 31 13 393 3 astC Succinylornithine transaminase Salmonella typhi
Q49W96 1.48e-38 146 27 14 401 3 rocD2 Ornithine aminotransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8X4S6 1.99e-38 146 30 14 414 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli O157:H7
P07991 2.12e-38 147 29 17 437 1 CAR2 Ornithine aminotransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q5HQK4 2.77e-38 145 27 14 411 3 rocD Ornithine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q7N9E5 3.04e-38 145 33 9 310 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P18335 3.18e-38 145 31 17 415 1 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli (strain K12)
A7FIL6 3.65e-38 146 34 9 309 3 astC Succinylornithine transaminase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B9ITF9 4.47e-38 145 29 13 405 3 rocD Ornithine aminotransferase Bacillus cereus (strain Q1)
Q66B21 5.89e-38 145 34 9 309 3 astC Succinylornithine transaminase Yersinia pseudotuberculosis serotype I (strain IP32953)
A9QZ63 6.01e-38 145 34 9 309 3 astC Succinylornithine transaminase Yersinia pestis bv. Antiqua (strain Angola)
Q8D0D7 6.01e-38 145 34 9 309 3 astC Succinylornithine transaminase Yersinia pestis
Q1C8B1 6.01e-38 145 34 9 309 3 astC Succinylornithine transaminase Yersinia pestis bv. Antiqua (strain Antiqua)
Q9M8M7 9.24e-38 145 29 13 395 1 WIN1 Acetylornithine aminotransferase, chloroplastic/mitochondrial Arabidopsis thaliana
Q9APM5 1.01e-37 145 28 16 442 1 tpa Taurine--pyruvate aminotransferase Bilophila wadsworthia
E5Y945 1.01e-37 145 28 16 442 1 tpa Taurine--pyruvate aminotransferase Bilophila wadsworthia (strain 3_1_6)
Q8CT82 1.06e-37 144 27 14 411 3 rocD Ornithine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P59321 1.17e-37 144 30 17 415 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Shigella flexneri
B9EAM9 1.22e-37 144 28 15 405 3 rocD Ornithine aminotransferase Macrococcus caseolyticus (strain JCSC5402)
Q9JYY4 1.3e-37 144 31 12 387 3 argD Acetylornithine aminotransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8CUM9 1.31e-37 144 28 13 407 3 argD Acetylornithine aminotransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
O82521 1.43e-37 145 26 12 416 1 VAMT Vanillin aminotransferase Capsicum chinense
Q07907 1.51e-37 143 29 13 411 3 argD Acetylornithine aminotransferase Geobacillus stearothermophilus
Q94CE5 1.54e-37 145 25 12 416 1 POP2 Gamma-aminobutyrate transaminase POP2, mitochondrial Arabidopsis thaliana
P59086 1.75e-37 144 28 15 396 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P40829 1.94e-37 144 31 12 411 3 gabT 4-aminobutyrate aminotransferase Mycobacterium leprae (strain TN)
Q7WKW5 2.21e-37 143 30 13 403 3 argD1 Acetylornithine aminotransferase 1 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W7H6 2.65e-37 143 30 13 403 3 argD1 Acetylornithine aminotransferase 1 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
C1EL61 2.7e-37 143 29 13 405 3 rocD Ornithine aminotransferase Bacillus cereus (strain 03BB102)
Q81TV3 2.96e-37 143 29 13 405 1 rocD Ornithine aminotransferase Bacillus anthracis
C3LBX0 2.96e-37 143 29 13 405 3 rocD Ornithine aminotransferase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3K3 2.96e-37 143 29 13 405 3 rocD Ornithine aminotransferase Bacillus anthracis (strain A0248)
Q1RB45 3.71e-37 143 30 14 393 3 astC Succinylornithine transaminase Escherichia coli (strain UTI89 / UPEC)
Q8FGZ9 3.71e-37 143 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH82 3.71e-37 143 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABS9 3.71e-37 143 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O1:K1 / APEC
B7MVM7 3.71e-37 143 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O81 (strain ED1a)
B7MAV9 3.71e-37 143 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q7N2G7 4.1e-37 142 31 10 329 3 astC Succinylornithine transaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6ZH29 4.73e-37 144 26 14 424 2 GABA-T Probable gamma-aminobutyrate transaminase 4 Oryza sativa subsp. japonica
Q7VTJ7 4.9e-37 142 30 13 403 3 argD1 Acetylornithine aminotransferase 1 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q9JTX9 6.02e-37 142 31 12 388 3 argD Acetylornithine aminotransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1JS45 6.17e-37 142 33 9 309 3 astC Succinylornithine transaminase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P59319 7.48e-37 142 33 12 349 3 argD Acetylornithine aminotransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q3Z295 1.15e-36 141 30 14 393 3 astC Succinylornithine transaminase Shigella sonnei (strain Ss046)
D6R3B6 1.16e-36 142 26 12 416 1 PAMT Vanillin aminotransferase Capsicum frutescens
P59317 1.34e-36 141 30 17 415 3 argD Acetylornithine/succinyldiaminopimelate aminotransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7LQ44 1.59e-36 141 30 14 393 3 astC Succinylornithine transaminase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7N584 1.69e-36 141 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q81GP2 3.23e-36 140 29 13 405 3 rocD Ornithine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q18040 3.42e-36 140 27 16 422 3 oatr-1 Probable ornithine aminotransferase, mitochondrial Caenorhabditis elegans
E1V7V7 4.08e-36 141 28 9 384 3 doeD Diaminobutyrate--2-oxoglutarate transaminase Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
O34662 4.09e-36 141 26 10 415 3 yodT Uncharacterized aminotransferase YodT Bacillus subtilis (strain 168)
B1LDY3 4.12e-36 140 30 14 393 3 astC Succinylornithine transaminase Escherichia coli (strain SMS-3-5 / SECEC)
A8A0U0 5.1e-36 140 30 16 394 3 astC Succinylornithine transaminase Escherichia coli O9:H4 (strain HS)
E1AQY3 5.88e-36 140 26 12 416 2 VAMT Vanillin aminotransferase Capsicum annuum
Q89VE9 6.2e-36 139 29 15 402 3 argD1 Acetylornithine aminotransferase 1 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B7USC9 6.31e-36 139 33 10 306 3 astC Succinylornithine transaminase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B6IBG8 6.37e-36 139 30 16 394 3 astC Succinylornithine transaminase Escherichia coli (strain SE11)
P77581 6.37e-36 139 30 16 394 1 astC Succinylornithine transaminase Escherichia coli (strain K12)
B1IPI2 6.37e-36 139 30 16 394 3 astC Succinylornithine transaminase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XGK9 6.37e-36 139 30 16 394 3 astC Succinylornithine transaminase Escherichia coli (strain K12 / DH10B)
C4ZZA4 6.37e-36 139 30 16 394 3 astC Succinylornithine transaminase Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1G0 6.37e-36 139 30 16 394 3 astC Succinylornithine transaminase Escherichia coli O8 (strain IAI1)
A7ZML6 6.37e-36 139 30 16 394 3 astC Succinylornithine transaminase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8P5Q4 6.88e-36 139 34 12 344 3 argD Acetylornithine aminotransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9X2A5 7.22e-36 139 28 10 395 1 argD Acetylornithine aminotransferase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P59320 7.99e-36 139 34 11 306 3 argD Acetylornithine aminotransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
O27392 8.33e-36 139 29 16 425 3 argD Acetylornithine aminotransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q7XN12 8.36e-36 141 26 12 438 2 Os04g0614500 Probable gamma-aminobutyrate transaminase 2, mitochondrial Oryza sativa subsp. japonica
Q01K12 8.36e-36 141 26 12 438 3 OsI_17384 Probable gamma-aminobutyrate transaminase 2, mitochondrial Oryza sativa subsp. indica
B9DIU0 9.59e-36 139 28 13 415 3 rocD Ornithine aminotransferase Staphylococcus carnosus (strain TM300)
B7NT29 1.03e-35 139 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q321P0 1.49e-35 139 30 14 393 3 astC Succinylornithine transaminase Shigella boydii serotype 4 (strain Sb227)
B2U3D0 1.49e-35 139 30 14 393 3 astC Succinylornithine transaminase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q7SI94 1.65e-35 138 29 13 388 3 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
O58478 2.36e-35 139 29 14 420 1 PH0782 Alanine/serine racemase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P59316 2.52e-35 138 26 16 420 3 argD Acetylornithine aminotransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A8AHE0 2.61e-35 138 30 14 393 3 astC Succinylornithine transaminase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7L6M2 4.5e-35 137 30 14 393 3 astC Succinylornithine transaminase Escherichia coli (strain 55989 / EAEC)
O30156 6.01e-35 136 28 12 409 3 argD Acetylornithine aminotransferase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
B5YQ35 6.95e-35 137 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X598 6.95e-35 137 30 14 393 3 astC Succinylornithine transaminase Escherichia coli O157:H7
Q89LG2 7.86e-35 136 31 10 343 3 argD2 Acetylornithine aminotransferase 2 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9VW26 9.13e-35 137 27 14 416 2 Oat Ornithine aminotransferase, mitochondrial Drosophila melanogaster
C4L2E7 1.94e-34 135 28 16 414 3 rocD Ornithine aminotransferase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
P49724 1.95e-34 136 28 15 415 1 Oat Ornithine aminotransferase, mitochondrial Drosophila ananassae
P73133 2.28e-34 135 26 15 427 1 argD Acetylornithine aminotransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9CC12 2.71e-34 135 29 14 396 3 argD Acetylornithine aminotransferase Mycobacterium leprae (strain TN)
P94427 2.83e-34 135 28 12 408 3 gabT Probable 4-aminobutyrate aminotransferase Bacillus subtilis (strain 168)
Q3ZCF5 3.59e-34 135 28 16 431 2 OAT Ornithine aminotransferase, mitochondrial Bos taurus
Q7V0G0 8.29e-34 134 25 11 392 3 argD Acetylornithine aminotransferase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q4JAP8 1.33e-33 133 27 11 380 1 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
P38021 1.74e-33 133 29 14 396 1 rocD Ornithine aminotransferase Bacillus subtilis (strain 168)
P36839 4.62e-33 131 28 14 398 3 argD Acetylornithine aminotransferase Bacillus subtilis (strain 168)
P50457 4.73e-33 132 28 12 396 1 puuE 4-aminobutyrate aminotransferase PuuE Escherichia coli (strain K12)
A0QYS9 5.14e-33 131 29 12 398 1 argD Acetylornithine aminotransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8PH31 5.8e-33 131 33 12 344 3 argD Acetylornithine aminotransferase Xanthomonas axonopodis pv. citri (strain 306)
Q9V1I4 5.85e-33 130 30 15 385 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus abyssi (strain GE5 / Orsay)
Q9K5Z2 8.3e-33 131 28 14 394 3 rocD Ornithine aminotransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q882K8 1.07e-32 130 29 13 384 3 argD2 Acetylornithine aminotransferase 2 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8U0B4 1.16e-32 130 29 16 385 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P59315 1.26e-32 131 28 14 404 3 argD Acetylornithine aminotransferase Bifidobacterium longum (strain NCC 2705)
C5D6R2 1.56e-32 130 27 13 393 3 rocD Ornithine aminotransferase Geobacillus sp. (strain WCH70)
P54752 2e-32 130 26 15 411 3 argD Acetylornithine aminotransferase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q4A0N2 2.21e-32 129 27 11 380 3 rocD1 Ornithine aminotransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
O57878 3.07e-32 130 26 14 426 1 PH0138 Broad substrate specificity amino-acid racemase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9A652 3.83e-32 129 32 14 389 3 argD2 Acetylornithine aminotransferase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
C0ZBR4 4.37e-32 129 29 9 322 3 rocD Ornithine aminotransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
P59322 4.72e-32 129 29 14 381 3 argD Acetylornithine aminotransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9CNT1 6.62e-32 128 30 12 333 3 argD Acetylornithine aminotransferase Pasteurella multocida (strain Pm70)
Q55DT8 7.33e-32 129 28 13 363 3 argD Probable acetylornithine aminotransferase, mitochondrial Dictyostelium discoideum
Q7VAS9 7.68e-32 129 26 14 407 3 argD Acetylornithine aminotransferase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
B0F481 1.1e-31 131 26 14 425 1 BIO3-BIO1 Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial Arabidopsis thaliana
Q87DM8 1.35e-31 128 34 12 332 3 argD Acetylornithine aminotransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A0A098DDI1 1.44e-31 129 28 9 345 3 FGRAMPH1_01T09365 Aminotransferase FGSG_17085 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
Q7VSA0 1.56e-31 127 29 14 399 3 rocD Ornithine aminotransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W1E4 1.56e-31 127 29 14 399 3 rocD Ornithine aminotransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WP51 1.56e-31 127 29 14 399 3 rocD Ornithine aminotransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q89RB7 2.42e-31 127 28 16 380 3 rocD Ornithine aminotransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8XWN8 2.42e-31 127 28 14 400 3 argD Acetylornithine aminotransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q88FI7 2.45e-31 127 30 15 392 1 PP_4108 2-aminoadipate transaminase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O59401 6.45e-31 125 28 13 398 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9CHD3 2.64e-30 124 30 15 375 3 argD Acetylornithine aminotransferase Lactococcus lactis subsp. lactis (strain IL1403)
H3ZR39 3.06e-30 124 28 14 427 1 OCC_10945 Leucine/methionine racemase Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
P9WPZ7 3.35e-30 124 29 13 410 1 argD Acetylornithine aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WPZ6 3.35e-30 124 29 13 410 3 argD Acetylornithine aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63569 3.35e-30 124 29 13 410 3 argD Acetylornithine aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
M1GRN3 4.77e-30 124 26 12 413 1 None Isoleucine 2-epimerase Lentilactobacillus buchneri
Q59928 6.51e-30 122 28 17 407 3 argD Acetylornithine aminotransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q5WL78 6.83e-30 123 29 14 400 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Shouchella clausii (strain KSM-K16)
Q7W979 7.33e-30 123 28 18 430 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHI8 7.33e-30 123 28 18 430 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q976K0 9.31e-30 122 28 12 360 3 lysJ [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q5W267 9.52e-30 125 30 8 325 1 pigE Aminotransferase PigE Serratia sp. (strain ATCC 39006)
Q7U5R5 1.04e-29 122 27 14 422 3 argD Acetylornithine aminotransferase Parasynechococcus marenigrum (strain WH8102)
Q82UP3 1.1e-29 122 30 12 318 3 argD Acetylornithine aminotransferase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9PDF2 1.14e-29 122 30 15 400 3 argD Acetylornithine aminotransferase Xylella fastidiosa (strain 9a5c)
A6VQ66 1.44e-29 122 28 16 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9YBY6 3.15e-29 120 29 11 383 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q5YW77 3.15e-29 121 30 17 415 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Nocardia farcinica (strain IFM 10152)
Q30WH2 3.29e-29 121 31 17 390 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
D5AKY0 4.81e-29 121 27 18 442 2 tpa Taurine--pyruvate aminotransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A1B9Z3 5.47e-29 121 26 16 441 1 hpa/tpa Hypotaurine/taurine--pyruvate aminotransferase Paracoccus denitrificans (strain Pd 1222)
O50131 8.01e-29 120 28 17 439 1 PH1423 Ornithine aminotransferase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q6ZKV8 9.84e-29 122 26 12 428 2 BIO3-BIO1 Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial Oryza sativa subsp. japonica
Q7V8L1 1.1e-28 120 27 13 390 3 argD Acetylornithine aminotransferase Prochlorococcus marinus (strain MIT 9313)
Q71Z79 1.95e-28 118 28 17 418 3 argD Acetylornithine aminotransferase Listeria monocytogenes serotype 4b (strain F2365)
P30900 2.19e-28 118 31 13 325 3 argD Acetylornithine aminotransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q5JEW1 2.42e-28 119 27 14 393 1 TK2101 Ornithine aminotransferase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8CSG1 3.57e-28 117 30 13 310 3 argD Acetylornithine aminotransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q818W2 4.22e-28 117 27 12 383 3 argD Acetylornithine aminotransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6C846 5.49e-28 117 28 10 334 3 ARG8 Acetylornithine aminotransferase, mitochondrial Yarrowia lipolytica (strain CLIB 122 / E 150)
Q6QUY9 5.72e-28 118 28 13 396 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces anulatus
Q5JFW3 8.22e-28 116 28 18 410 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q829L4 1.02e-27 117 28 15 407 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A0A0J9X1Q5 1.25e-27 119 30 10 329 1 pigE Aminotransferase PigE Serratia sp. (strain FS14)
Q6BUP9 1.42e-27 117 24 14 424 3 ARG8 Acetylornithine aminotransferase, mitochondrial Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968)
Q9US34 1.46e-27 117 27 16 419 3 SPAC1039.07c Uncharacterized aminotransferase C1039.07c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5WWG1 1.79e-27 116 31 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Lens)
Q75AW1 2.73e-27 116 26 14 394 3 ARG8 Acetylornithine aminotransferase, mitochondrial Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)
Q9KED4 2.81e-27 116 29 15 403 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P59318 2.81e-27 115 27 13 405 3 argD Acetylornithine aminotransferase Myxococcus xanthus
O74548 3.72e-27 115 28 17 402 2 arg1 Probable acetylornithine aminotransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A5IC29 3.78e-27 115 31 13 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Corby)
Q5HP24 4.39e-27 114 30 13 310 3 argD Acetylornithine aminotransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P55628 4.51e-27 115 29 19 416 3 NGR_a01910 Uncharacterized aminotransferase y4qG Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9CNG9 5.51e-27 115 27 17 423 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pasteurella multocida (strain Pm70)
Q81M98 7.28e-27 114 27 12 384 3 argD Acetylornithine aminotransferase Bacillus anthracis
Q5JGG6 7.95e-27 115 27 12 418 1 TK1211 Leucine/methionine racemase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q5X529 9.34e-27 114 31 13 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila (strain Paris)
Q7NN66 1.05e-26 114 29 17 413 3 argD Acetylornithine aminotransferase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9AP34 1.09e-26 114 29 10 334 2 ectB Diaminobutyrate--2-oxoglutarate transaminase Sporosarcina pasteurii
Q5ZVA6 1.1e-26 114 30 13 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P18544 1.38e-26 114 24 11 388 1 ARG8 Acetylornithine aminotransferase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P9WQ79 1.47e-26 114 31 17 431 1 gabT 4-aminobutyrate aminotransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQ78 1.47e-26 114 31 17 431 3 gabT 4-aminobutyrate aminotransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P63505 1.47e-26 114 31 17 431 3 gabT 4-aminobutyrate aminotransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q92BC0 1.76e-26 113 27 17 418 3 argD Acetylornithine aminotransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q5AYI6 2.43e-26 115 25 12 405 1 bioDA Bifunctional dethiobiotin synthetase/adenosylmethionine-8-amino-7-oxononanoate aminotransferase Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)
Q93RW1 2.47e-26 113 27 16 412 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q94AL9 2.88e-26 114 26 13 444 1 AGT3 Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial Arabidopsis thaliana
Q9Z3R2 3.75e-26 113 29 15 427 3 rhbA Diaminobutyrate--2-oxoglutarate aminotransferase Rhizobium meliloti (strain 1021)
Q8ZV07 4.12e-26 112 26 13 388 3 lysJ Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q828A3 6.59e-26 112 28 15 407 3 argD Acetylornithine aminotransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q8PW58 1.07e-25 111 26 18 421 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q8KAQ7 1.57e-25 111 27 16 412 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P56744 1.85e-25 111 26 15 446 1 dat Diaminobutyrate--2-oxoglutarate aminotransferase Acinetobacter baumannii
B5Y1L5 2.01e-25 110 29 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Klebsiella pneumoniae (strain 342)
Q725I1 3.25e-25 110 30 14 337 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
O06060 3.81e-25 110 27 15 417 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Marinococcus halophilus
Q8Y6U4 4.02e-25 109 28 19 424 3 argD Acetylornithine aminotransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B3GYN8 4.48e-25 109 28 18 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q9L1A4 4.68e-25 109 31 10 304 3 argD Acetylornithine aminotransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B0BRF0 4.84e-25 109 28 18 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q6PR32 5.11e-25 109 26 12 397 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Virgibacillus pantothenticus
P16932 5.79e-25 109 25 16 447 1 dgdA 2,2-dialkylglycine decarboxylase Burkholderia cepacia
A6T4V8 5.87e-25 109 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A3N2K3 5.92e-25 109 28 18 393 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P44951 6.57e-25 109 29 16 385 1 dat Diaminobutyrate--2-oxoglutarate aminotransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1V9X6 6.82e-25 109 30 13 337 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Nitratidesulfovibrio vulgaris (strain DP4)
C5BAP9 7.4e-25 109 27 13 357 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Edwardsiella ictaluri (strain 93-146)
O14433 9.38e-25 108 26 13 383 3 ARG8 Acetylornithine aminotransferase, mitochondrial Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)
Q65U43 9.78e-25 108 29 15 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8D3C8 1.09e-24 108 28 14 316 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Wigglesworthia glossinidia brevipalpis
Q47V96 1.49e-24 108 28 18 388 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A0LXY3 1.57e-24 108 30 14 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q2NVQ0 1.86e-24 108 31 11 298 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Sodalis glossinidius (strain morsitans)
B6HZD0 2.03e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain SE11)
B7N823 2.03e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A7ZWA2 2.03e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O9:H4 (strain HS)
Q2RJ31 2.16e-24 108 31 15 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A1S3U0 2.26e-24 107 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
P0CL07 2.3e-24 107 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1W874 2.3e-24 107 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella typhimurium (strain SL1344)
C4LAK4 2.31e-24 107 28 16 386 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q6FXA4 2.37e-24 107 25 12 383 3 ARG8 Acetylornithine aminotransferase, mitochondrial Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138)
B2U2Z9 2.58e-24 107 28 14 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A3QBN5 2.74e-24 107 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q325Y5 2.98e-24 107 28 14 335 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella boydii serotype 4 (strain Sb227)
Q7MAE6 3.09e-24 107 26 23 425 3 argD Acetylornithine aminotransferase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q3Z5K3 3.13e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella sonnei (strain Ss046)
B1IQI6 3.22e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M195 3.22e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O8 (strain IAI1)
B7LGL6 3.22e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain 55989 / EAEC)
A7ZHP6 3.22e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1YJU8 3.36e-24 107 28 18 415 3 hemL2 Glutamate-1-semialdehyde 2,1-aminomutase 2 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B5BL82 4.01e-24 107 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi A (strain AKU_12601)
Q5PD43 4.01e-24 107 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B1LGV7 4.05e-24 107 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain SMS-3-5 / SECEC)
B5Z0D4 4.46e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X4V5 4.46e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O157:H7
B3QSA6 4.65e-24 107 29 14 341 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A0LIP3 4.78e-24 107 30 10 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B4TK30 4.86e-24 107 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella heidelberg (strain SL476)
Q32JV4 4.91e-24 107 27 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella dysenteriae serotype 1 (strain Sd197)
P23893 5.78e-24 106 27 14 336 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain K12)
B1XD24 5.78e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain K12 / DH10B)
C4ZRP7 5.78e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain K12 / MC4100 / BW2952)
B4SUY4 6.3e-24 106 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella newport (strain SL254)
B5R3G6 6.54e-24 106 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella enteritidis PT4 (strain P125109)
Q8Z9B4 6.61e-24 106 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella typhi
Q1DFA7 6.68e-24 106 30 11 315 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Myxococcus xanthus (strain DK1622)
B7MP16 6.74e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O81 (strain ED1a)
B4S3Q6 6.88e-24 106 26 16 417 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q1RG34 7.13e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli (strain UTI89 / UPEC)
Q8FL16 7.13e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH7 7.13e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K0 7.13e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O1:K1 / APEC
B7MBD7 7.13e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK1 7.13e-24 106 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8ESU8 8.16e-24 106 26 15 411 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B5RHE0 8.98e-24 106 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B8F7H5 9.51e-24 105 26 12 342 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Glaesserella parasuis serovar 5 (strain SH0165)
C0Q5R5 1.05e-23 105 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi C (strain RKS4594)
Q57T53 1.05e-23 105 28 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella choleraesuis (strain SC-B67)
B3QRD2 1.05e-23 105 26 15 412 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B7NIB7 1.13e-23 105 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8TT57 1.28e-23 105 28 11 309 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
A4SGT2 1.45e-23 105 29 16 344 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q9BYV1 1.46e-23 106 27 14 378 1 AGXT2 Alanine--glyoxylate aminotransferase 2, mitochondrial Homo sapiens
A8FS76 1.58e-23 105 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sediminis (strain HAW-EB3)
Q12KC8 1.75e-23 105 30 15 330 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8ALD5 1.79e-23 105 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2UNE3 2.52e-23 104 29 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A9N0P9 2.67e-23 104 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q821C1 2.75e-23 104 26 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella flexneri
Q0T852 2.75e-23 104 26 17 387 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shigella flexneri serotype 5b (strain 8401)
Q2S1S3 2.9e-23 104 31 13 296 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salinibacter ruber (strain DSM 13855 / M31)
Q10174 3e-23 105 28 8 295 3 SPAC27F1.05c Uncharacterized aminotransferase C27F1.05c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9SR86 3.06e-23 105 25 9 397 2 At3g08860 Alanine--glyoxylate aminotransferase 2 homolog 3, mitochondrial Arabidopsis thaliana
Q87NZ7 3.08e-23 104 30 10 321 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A1JJQ1 3.26e-23 104 28 15 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B4TXQ6 3.29e-23 104 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella schwarzengrund (strain CVM19633)
B5FJ01 3.29e-23 104 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella dublin (strain CT_02021853)
B3EKJ7 3.45e-23 104 26 16 417 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium phaeobacteroides (strain BS1)
A5UU40 3.52e-23 104 31 11 319 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Roseiflexus sp. (strain RS-1)
Q0HSE6 3.66e-23 104 29 14 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain MR-7)
Q3B1A1 4.14e-23 104 29 14 317 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A7MGR5 4.91e-23 103 27 13 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Cronobacter sakazakii (strain ATCC BAA-894)
B1KHF6 5.2e-23 103 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella woodyi (strain ATCC 51908 / MS32)
Q46CH1 5.2e-23 103 28 12 345 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Methanosarcina barkeri (strain Fusaro / DSM 804)
B7LWB5 5.62e-23 103 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B3EI07 6.98e-23 103 26 16 417 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q9RWW0 7.97e-23 103 31 12 337 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7N845 8.14e-23 103 28 13 327 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MPK7 8.38e-23 103 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B2VE25 8.87e-23 103 27 14 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q8EHC8 1.07e-22 103 29 14 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B1I4L1 1.28e-22 102 30 11 323 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Desulforudis audaxviator (strain MP104C)
Q6D1Z0 1.29e-22 102 28 13 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B5F8R5 1.4e-22 102 28 14 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Salmonella agona (strain SL483)
C3LSN1 1.49e-22 102 29 16 340 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU97 1.49e-22 102 29 16 340 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F945 1.49e-22 102 29 16 340 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9ZEU7 1.51e-22 102 30 13 340 1 ectB Diaminobutyrate--2-oxoglutarate transaminase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1KB59 1.74e-22 102 29 12 337 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Azoarcus sp. (strain BH72)
C6DC32 1.9e-22 102 28 13 328 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q87LY3 1.98e-22 102 28 15 340 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A8G9U7 2.29e-22 102 28 14 333 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Serratia proteamaculans (strain 568)
Q39QA6 2.41e-22 102 29 14 341 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A9B550 2.69e-22 102 29 13 331 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
C4K6Y5 2.69e-22 102 29 12 309 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q2JS70 2.7e-22 102 30 14 320 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain JA-3-3Ab)
Q0HG53 2.93e-22 101 29 14 307 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella sp. (strain MR-4)
A1BJG8 3.34e-22 101 26 16 417 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0TIQ0 3.35e-22 101 28 14 317 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella halifaxensis (strain HAW-EB4)
A8H164 3.38e-22 101 28 14 317 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A7NKV1 3.4e-22 101 32 11 296 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A4TPW6 3.62e-22 101 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis (strain Pestoides F)
Q1CLU7 3.62e-22 101 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E6 3.62e-22 101 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBL9 3.62e-22 101 28 14 332 1 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis
Q1C3X1 3.62e-22 101 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pestis bv. Antiqua (strain Antiqua)
B5ERN9 3.75e-22 101 28 13 323 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JBI1 3.75e-22 101 28 13 323 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B1ZVF7 3.8e-22 101 28 11 338 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Opitutus terrae (strain DSM 11246 / JCM 15787 / PB90-1)
Q9LCS5 3.97e-22 100 27 16 410 3 argD Acetylornithine aminotransferase Streptomyces clavuligerus
Q17QF0 4.4e-22 102 27 14 379 2 AGXT2 Alanine--glyoxylate aminotransferase 2, mitochondrial Bos taurus
Q8RFY7 4.55e-22 101 28 11 313 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A4W6Q1 4.67e-22 101 27 14 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Enterobacter sp. (strain 638)
Q940M2 5.96e-22 101 24 11 442 1 AGT2 Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial Arabidopsis thaliana
B1JK22 6.09e-22 100 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EF1 6.09e-22 100 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K547 6.09e-22 100 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FM09 6.09e-22 100 28 14 332 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7M9K2 6.15e-22 100 26 15 420 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q9KLC2 6.18e-22 100 29 14 358 3 ectB Diaminobutyrate--2-oxoglutarate transaminase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q2JMP7 6.33e-22 100 29 14 320 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Synechococcus sp. (strain JA-2-3B'a(2-13))
B4EUE1 6.44e-22 100 27 13 336 3 hemL Glutamate-1-semialdehyde 2,1-aminomutase Proteus mirabilis (strain HI4320)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00715
Feature type CDS
Gene bioA
Product adenosylmethionine--8-amino-7-oxononanoate transaminase
Location 148630 - 149934 (strand: -1)
Length 1305 (nucleotides) / 434 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1538
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00202 Aminotransferase class-III

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0161 Coenzyme transport and metabolism (H) H Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

Kegg Ortholog Annotation(s)

Protein Sequence

MTLTPHFPESGWSDDDADFDRKHIWHPYTSMSNPLPVYPVASAQGAILTLEDGRELVDGMSSWWAAIHGYNHPVLNEAVTTQLSQMSHVMFGGITHSPAVALCRRLVAITPAPLECVFLADSGSVAVEVALKMALQYWQARGEKRHRFVTPRHGYHGDTFGAMSVCDPENSMHDLWQGYLPNHLFADAPQCGFYDEWDSKDLTSMETLLAAHHRDVAAVILEPVVQGAGGMRFYHPQYLKGVRSLCDRYNILLIADEIATGFGRTGKLFACEQAGISPDIMCLGKAITGGYMTLSATLTTRHIADTISQGDAGCFMHGPTFMGNPLACATAVACIDLLLSGNWAERVAEIELQLKAALMPLKTRSGVRDVRVLGAIGVVETQKPVNMGELQRKFVDAGVWIRPFGRLIYLMPPYIITDEQLQKLTQAIDLVTSE

Flanking regions ( +/- flanking 50bp)

AATATCATCATTATCATGTCAACTATATTTGAATTGATTTGGTTTACATAATGACATTGACTCCTCATTTTCCGGAGAGCGGCTGGTCAGATGATGATGCTGATTTTGACCGGAAACATATCTGGCACCCTTATACATCAATGAGTAATCCGCTACCGGTCTATCCGGTTGCATCCGCACAAGGTGCAATACTGACACTTGAAGACGGGCGCGAACTGGTTGACGGTATGTCCTCCTGGTGGGCGGCAATCCACGGCTATAATCATCCGGTACTTAATGAGGCGGTCACGACGCAGCTCTCACAGATGTCACATGTGATGTTCGGCGGGATCACTCATTCGCCCGCCGTTGCGTTGTGCCGCCGCCTGGTGGCAATCACACCTGCGCCGCTGGAGTGTGTGTTTTTAGCCGACTCCGGCTCTGTCGCCGTGGAAGTGGCGCTGAAAATGGCACTGCAATACTGGCAGGCACGCGGCGAAAAACGTCACCGCTTTGTGACTCCGCGCCACGGCTATCACGGCGACACGTTCGGCGCGATGTCAGTGTGCGACCCGGAAAATTCAATGCATGACCTCTGGCAGGGCTATCTGCCAAATCACCTGTTTGCTGATGCACCGCAGTGCGGATTTTACGATGAGTGGGACAGTAAAGACCTTACCTCCATGGAAACACTGCTGGCAGCACATCACAGGGATGTGGCGGCAGTTATTCTGGAGCCGGTTGTCCAGGGCGCGGGCGGCATGCGTTTTTACCATCCGCAATACCTGAAAGGCGTGAGAAGCCTGTGTGATCGCTACAATATCCTGCTGATTGCCGACGAGATAGCCACCGGTTTTGGTCGCACAGGGAAATTATTCGCCTGTGAACAGGCCGGAATATCACCGGACATTATGTGTCTTGGTAAAGCGATTACCGGGGGTTATATGACTCTCTCCGCCACACTCACCACCCGCCATATCGCAGACACCATCAGTCAGGGTGATGCGGGCTGCTTTATGCACGGTCCGACTTTTATGGGCAACCCGCTCGCCTGCGCCACAGCGGTCGCCTGTATTGACCTGCTGCTGTCGGGGAATTGGGCTGAACGCGTTGCAGAGATTGAATTGCAACTGAAAGCCGCACTGATGCCACTAAAAACTCGCAGCGGTGTTCGTGATGTGCGGGTTCTGGGAGCAATCGGCGTTGTTGAAACGCAAAAGCCGGTCAATATGGGGGAATTACAGCGCAAATTTGTCGATGCCGGGGTGTGGATACGTCCGTTCGGGCGTCTGATCTATCTTATGCCGCCGTATATCATCACTGATGAACAACTGCAAAAACTCACTCAGGCGATTGATTTGGTGACCAGCGAATAAAAACCGGAGAATACATTGACACCGGGGGCGCTGACAACGGGCAAAAACGA