Homologs in group_1227

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06700 FBDBKF_06700 100.0 Morganella morganii S1 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
EHELCC_04270 EHELCC_04270 100.0 Morganella morganii S2 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
LHKJJB_10100 LHKJJB_10100 100.0 Morganella morganii S3 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
HKOGLL_08875 HKOGLL_08875 100.0 Morganella morganii S5 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
F4V73_RS00840 F4V73_RS00840 92.7 Morganella psychrotolerans - GlsB/YeaQ/YmgE family stress response membrane protein
PMI_RS03065 PMI_RS03065 75.6 Proteus mirabilis HI4320 - GlsB/YeaQ/YmgE family stress response membrane protein

Distribution of the homologs in the orthogroup group_1227

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1227

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64485 4.62e-24 89 74 0 79 3 yeaQ UPF0410 protein YeaQ Escherichia coli (strain K12)
P64486 4.62e-24 89 74 0 79 3 yeaQ UPF0410 protein YeaQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64487 4.62e-24 89 74 0 79 3 yeaQ UPF0410 protein YeaQ Escherichia coli O157:H7
P58767 2.06e-18 75 56 1 75 3 ymgE UPF0410 protein YmgE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P76011 1.61e-17 72 54 1 75 3 ymgE UPF0410 protein YmgE Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_04270
Feature type CDS
Gene yeaQ
Product Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
Location 183226 - 183474 (strand: -1)
Length 249 (nucleotides) / 82 (amino acids)
In genomic island GI12

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1227
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04226 Transglycosylase associated protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2261 General function prediction only (R) R Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family

Protein Sequence

MNFLSWIIFGLIAGVLAKWIMPGTYSIGIIMTIVLGVVGAVVGGYISVFFGKGRVDGFNFGSFVVAVIGAMVVLFLAGKFAG

Flanking regions ( +/- flanking 50bp)

ACAGGTGAGCCGGATTTTTTCTTAACCCGTTAATACAGCAGGAGGTACTGATGAATTTTCTGTCCTGGATTATTTTTGGCCTGATCGCCGGTGTGCTGGCGAAATGGATTATGCCCGGAACCTATAGTATCGGCATTATTATGACGATTGTACTGGGTGTTGTTGGTGCTGTTGTCGGGGGATATATCAGTGTTTTCTTCGGCAAGGGGCGTGTCGACGGGTTTAATTTCGGCAGCTTTGTGGTAGCGGTGATCGGTGCGATGGTGGTGCTGTTTCTCGCCGGGAAGTTTGCGGGCTGACAGCCGCATAACAGATTTAAAAAATGCCGGAGCAGCTGACGCGCTCCGGC