Homologs in group_1227

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06700 FBDBKF_06700 92.7 Morganella morganii S1 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
EHELCC_04270 EHELCC_04270 92.7 Morganella morganii S2 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
NLDBIP_04270 NLDBIP_04270 92.7 Morganella morganii S4 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
LHKJJB_10100 LHKJJB_10100 92.7 Morganella morganii S3 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
HKOGLL_08875 HKOGLL_08875 92.7 Morganella morganii S5 yeaQ Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family
PMI_RS03065 PMI_RS03065 74.4 Proteus mirabilis HI4320 - GlsB/YeaQ/YmgE family stress response membrane protein

Distribution of the homologs in the orthogroup group_1227

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1227

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64485 1.06e-23 88 72 0 79 3 yeaQ UPF0410 protein YeaQ Escherichia coli (strain K12)
P64486 1.06e-23 88 72 0 79 3 yeaQ UPF0410 protein YeaQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64487 1.06e-23 88 72 0 79 3 yeaQ UPF0410 protein YeaQ Escherichia coli O157:H7
P58767 1.53e-18 75 54 1 75 3 ymgE UPF0410 protein YmgE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P76011 1.14e-17 73 53 1 75 3 ymgE UPF0410 protein YmgE Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00840
Feature type CDS
Gene -
Product GlsB/YeaQ/YmgE family stress response membrane protein
Location 174515 - 174763 (strand: 1)
Length 249 (nucleotides) / 82 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1227
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04226 Transglycosylase associated protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2261 General function prediction only (R) R Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family

Protein Sequence

MNFLSWIIFGLIAGVLAKWVMPGTYNIGFIMTIILGVAGSVVGGYISVFFGKGRVDGFNFGSFVVAVIGAMVVLFLAGKFAG

Flanking regions ( +/- flanking 50bp)

TTAACTGAGCCACAACGTTTTCTGAATCATACAGCCGGAGGGAGGCACTAATGAATTTTTTGTCCTGGATTATCTTTGGTCTGATTGCAGGGGTACTGGCTAAATGGGTTATGCCCGGAACCTATAATATCGGTTTTATTATGACAATCATATTAGGGGTTGCCGGCTCTGTGGTCGGGGGATATATCAGTGTCTTTTTCGGCAAAGGGCGTGTAGACGGGTTTAATTTCGGCAGTTTTGTCGTGGCCGTTATTGGTGCCATGGTGGTGTTATTTCTGGCAGGTAAATTTGCCGGCTGAATGTTAGCTGGTTAAATCATAGTTATGGGCTGATACCACAGCAAAAAGCA