Homologs in group_1242

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06815 FBDBKF_06815 100.0 Morganella morganii S1 lrgB CidB/LrgB family autolysis modulator
EHELCC_04155 EHELCC_04155 100.0 Morganella morganii S2 lrgB CidB/LrgB family autolysis modulator
LHKJJB_09985 LHKJJB_09985 100.0 Morganella morganii S3 lrgB CidB/LrgB family autolysis modulator
HKOGLL_08990 HKOGLL_08990 100.0 Morganella morganii S5 lrgB CidB/LrgB family autolysis modulator
F4V73_RS00955 F4V73_RS00955 93.1 Morganella psychrotolerans - CidB/LrgB family autolysis modulator
PMI_RS03175 PMI_RS03175 74.5 Proteus mirabilis HI4320 - CidB/LrgB family autolysis modulator

Distribution of the homologs in the orthogroup group_1242

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1242

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD20 2.03e-126 360 73 0 231 3 yohK Inner membrane protein YohK Shigella flexneri
P0AD19 2.03e-126 360 73 0 231 1 yohK Inner membrane protein YohK Escherichia coli (strain K12)
P45146 6.45e-48 160 41 0 216 3 HI_1298 Uncharacterized protein HI_1298 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P42102 5.16e-40 140 35 0 212 3 yxaC Uncharacterized protein YxaC Bacillus subtilis (strain 168)
P60640 3.96e-38 135 36 6 229 3 cidB Holin-like protein CidB Staphylococcus aureus (strain MW2)
Q6G6D4 3.96e-38 135 36 6 229 3 cidB Holin-like protein CidB Staphylococcus aureus (strain MSSA476)
P60638 3.96e-38 135 36 6 229 3 cidB Holin-like protein CidB Staphylococcus aureus (strain N315)
P60637 3.96e-38 135 36 6 229 3 cidB Holin-like protein CidB Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HD11 3.96e-38 135 36 6 229 3 cidB Holin-like protein CidB Staphylococcus aureus (strain COL)
P60639 3.96e-38 135 36 6 229 1 cidB Holin-like protein CidB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q6GDQ8 4.13e-38 135 36 6 229 3 cidB Holin-like protein CidB Staphylococcus aureus (strain MRSA252)
Q8CR39 1.04e-35 129 35 1 220 3 cidB Holin-like protein CidB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HL71 1.04e-35 129 35 1 220 3 cidB Holin-like protein CidB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P39590 4.99e-34 124 36 0 216 3 ywbG Uncharacterized protein YwbG Bacillus subtilis (strain 168)
A9VTH6 2.52e-28 110 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus mycoides (strain KBAB4)
Q6HAJ7 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630G4 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain ZK / E33L)
Q814J3 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9ISZ3 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain Q1)
B7HZC3 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain AH187)
B7HGA1 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain B4264)
C1ER33 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain 03BB102)
B7IRX1 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain G9842)
Q72X07 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JIF5 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus cereus (strain AH820)
Q81JL5 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus anthracis
C3LGP7 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P2J6 5.13e-28 109 32 0 195 3 lrgB Antiholin-like protein LrgB Bacillus anthracis (strain A0248)
A7GVI2 9.19e-28 108 32 0 197 3 lrgB Antiholin-like protein LrgB Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q4A012 9.24e-28 108 33 0 198 3 lrgB Antiholin-like protein LrgB Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5HLG0 1.86e-27 107 33 3 221 3 lrgB Antiholin-like protein LrgB Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CN53 2.69e-27 107 33 3 221 3 lrgB Antiholin-like protein LrgB Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P94516 6.96e-27 106 34 0 178 3 lrgB Antiholin-like protein LrgB Bacillus subtilis (strain 168)
P60644 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain MW2)
A8Z0M6 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCK9 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain MSSA476)
Q6GK49 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain MRSA252)
P60642 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain N315)
P60641 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QDN7 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain Newman)
Q5HJB3 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain COL)
Q2YV65 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IPD2 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain JH9)
P60643 9.57e-25 100 31 2 214 1 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK07 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain USA300)
A6TY48 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain JH1)
A7WXS7 9.57e-25 100 31 2 214 3 lrgB Antiholin-like protein LrgB Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q9FVQ4 1.06e-11 67 25 2 174 1 PLGG1 Plastidal glycolate/glycerate translocator 1, chloroplastic Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_04155
Feature type CDS
Gene lrgB
Product CidB/LrgB family autolysis modulator
Location 158723 - 159418 (strand: 1)
Length 696 (nucleotides) / 231 (amino acids)
In genomic island -

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1242
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04172 LrgB-like family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1346 Cell wall/membrane/envelope biogenesis (M) M Putative effector of murein hydrolase

Protein Sequence

MLTHIWWSLPLTIGVYFLARAIYIKFKLPVLNPLLISIVIIIPLLIFTGTSYNHYFEGSRILNDLLQPAVVALAFPLYEQLHQIRAQWKSIITICFAGSVIAMVTGTAIAFMMGATPEIAASILPKSVTTPIAIAVSNSIGGVAAISAVCVIFVGILGAIFGHTLFRRLRVTTKASRGLAMGTASHALGTARCAEEDYVEGAYSSLALMTCGIITSLMAPFIFPVLLALFG

Flanking regions ( +/- flanking 50bp)

GCCGATGCGGTTGCCGCAGCAGAACACACCGAACAACAAGAGAAACGCAAATGTTAACGCATATCTGGTGGTCGCTCCCGCTTACCATCGGCGTCTATTTTCTCGCCAGAGCTATCTATATCAAATTTAAGCTGCCGGTATTAAACCCGCTGCTGATATCCATCGTGATTATCATTCCGCTGCTGATATTCACCGGAACTTCATACAACCACTATTTTGAGGGCAGCCGCATCCTCAACGATCTGCTGCAACCCGCCGTGGTGGCACTGGCGTTCCCGCTGTATGAGCAGCTGCATCAGATCCGTGCACAGTGGAAATCCATCATCACCATCTGCTTTGCCGGGAGTGTGATTGCCATGGTCACCGGTACCGCTATTGCCTTTATGATGGGCGCGACACCGGAAATTGCCGCCTCTATCCTGCCGAAATCTGTCACCACCCCGATAGCGATCGCGGTGTCCAATTCCATCGGCGGCGTGGCGGCAATCAGTGCCGTATGTGTGATTTTCGTCGGGATCCTCGGTGCGATTTTCGGCCATACCCTGTTCAGACGACTGCGGGTCACCACCAAGGCTTCACGCGGTCTGGCAATGGGTACGGCTTCTCACGCCCTCGGTACCGCCCGCTGCGCGGAAGAGGATTATGTGGAAGGCGCTTACAGTTCACTGGCATTAATGACCTGCGGGATTATTACTTCTCTGATGGCGCCATTTATCTTCCCGGTGCTGCTGGCATTATTCGGTTGACCTGAAAATTTGAGTTCTATCTCGCAAATTAAATATTTGTTTCATTTGTT