Homologs in group_1313

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07315 FBDBKF_07315 100.0 Morganella morganii S1 pqiC membrane integrity-associated transporter subunit PqiC
EHELCC_03655 EHELCC_03655 100.0 Morganella morganii S2 pqiC membrane integrity-associated transporter subunit PqiC
LHKJJB_09485 LHKJJB_09485 100.0 Morganella morganii S3 pqiC membrane integrity-associated transporter subunit PqiC
HKOGLL_09490 HKOGLL_09490 100.0 Morganella morganii S5 pqiC membrane integrity-associated transporter subunit PqiC
F4V73_RS01500 F4V73_RS01500 82.1 Morganella psychrotolerans pqiC membrane integrity-associated transporter subunit PqiC
PMI_RS03825 PMI_RS03825 49.2 Proteus mirabilis HI4320 pqiC membrane integrity-associated transporter subunit PqiC

Distribution of the homologs in the orthogroup group_1313

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1313

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AB11 1.79e-48 159 44 3 193 3 pqiC Intermembrane transport lipoprotein PqiC Shigella flexneri
P0AB10 1.79e-48 159 44 3 193 1 pqiC Intermembrane transport lipoprotein PqiC Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_03655
Feature type CDS
Gene pqiC
Product membrane integrity-associated transporter subunit PqiC
Location 37565 - 38152 (strand: -1)
Length 588 (nucleotides) / 195 (amino acids)
In genomic island -

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1313
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03886 ABC-type transport auxiliary lipoprotein component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3009 Cell wall/membrane/envelope biogenesis (M) M Intermembrane transporter PqiABC lipoprotein subunit PqiC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09857 intermembrane transport lipoprotein PqiC - -

Protein Sequence

MKKLTKALAFLGVFVLAGCSSTPVKQYYQLPVVAADSSSEQTSFRSNGSDNRHPQLWIQRITLGDVLGNAGIVYQTSDVEYNIGSTNLWAGPLEQQLLEVMTTELSQALPDRLVSVQPLESKPDTLTVTVTGFHGRYDGKVIVAGSWIYTYGDAVIRHPFNLVLEQAENGYPALVRTLGEGWAQVSKSVADELRK

Flanking regions ( +/- flanking 50bp)

TGAAGCCGCGCCGCAGGCGGATCCGCAACCTAAGAAGGCGAAGAATTAAGATGAAGAAACTGACAAAAGCACTGGCATTCCTGGGCGTTTTTGTACTGGCGGGGTGCAGCAGCACCCCGGTGAAACAGTATTATCAGTTACCAGTGGTGGCTGCGGACAGTAGCAGTGAACAGACCAGCTTCCGCAGTAACGGCAGTGACAACCGCCACCCTCAGTTATGGATCCAGCGTATCACGCTCGGGGATGTGCTGGGAAATGCCGGGATTGTCTATCAGACCAGTGATGTGGAATACAACATCGGCAGCACTAACTTATGGGCCGGTCCGCTGGAGCAGCAGTTGCTGGAAGTAATGACGACGGAACTCAGTCAGGCACTGCCGGACAGACTGGTTTCGGTGCAGCCGCTGGAAAGTAAACCGGATACCCTGACTGTCACTGTCACCGGTTTCCACGGCCGTTATGACGGCAAAGTGATTGTGGCGGGCAGCTGGATTTACACCTACGGTGACGCGGTTATCCGCCACCCGTTTAATCTGGTACTGGAACAGGCGGAAAACGGCTATCCGGCGCTGGTACGTACGCTGGGGGAAGGCTGGGCGCAGGTATCAAAATCGGTGGCTGACGAGCTGCGTAAGTAATTGCTGGTTTACTCTCTGCACCGGATGTGCAGAGAGTAAATTGTCATCAA