Homologs in group_1327

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07440 FBDBKF_07440 100.0 Morganella morganii S1 tehB Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily
EHELCC_03530 EHELCC_03530 100.0 Morganella morganii S2 tehB Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily
LHKJJB_09360 LHKJJB_09360 100.0 Morganella morganii S3 tehB Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily
HKOGLL_09615 HKOGLL_09615 100.0 Morganella morganii S5 tehB Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily
F4V73_RS01660 F4V73_RS01660 90.9 Morganella psychrotolerans - DUF1971 domain-containing protein
PMI_RS03920 PMI_RS03920 78.2 Proteus mirabilis HI4320 - DUF1971 domain-containing protein

Distribution of the homologs in the orthogroup group_1327

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1327

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P64488 4.57e-51 159 67 0 104 1 yeaR Uncharacterized protein YeaR Escherichia coli (strain K12)
P64489 4.57e-51 159 67 0 104 4 yeaR Uncharacterized protein YeaR Escherichia coli O157:H7
E1X791 1.83e-08 53 28 2 95 2 tehB Probable S-adenosyl-L-methionine-dependent methyltransferase TehB Haemophilus influenzae (strain 10810)
P45134 2.97e-08 53 27 2 95 1 tehB Probable S-adenosyl-L-methionine-dependent methyltransferase TehB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_03530
Feature type CDS
Gene tehB
Product Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily
Location 14928 - 15260 (strand: 1)
Length 333 (nucleotides) / 110 (amino acids)
In genomic island -

Contig

Accession ZDB_520
Length 336657 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1327
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF09313 Domain of unknown function (DUF1971)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3615 Inorganic ion transport and metabolism (P) P Tellurite resistance protein TehB, SAM-dependent methylase, cupin superfamily

Protein Sequence

MERIIIPTNYIHVRSTPLWTKETAPKSIWQRHLDKGTRQGVYPKLSVMQGTIVYYSYADETSPEPTDTLVIQAGQFGVFPPETWHRIEAVTDDTVFNVDFYVAPEILTEE

Flanking regions ( +/- flanking 50bp)

GTATTTTAATATTGAGTATTAATCATGTGTTTAACTTCAGGAGAACACAGATGGAACGCATCATCATTCCGACTAACTACATTCATGTCCGCAGCACCCCGCTCTGGACCAAAGAAACCGCACCGAAATCTATCTGGCAAAGACATCTGGATAAAGGCACCCGTCAGGGCGTTTATCCTAAACTGTCTGTTATGCAGGGCACGATTGTTTACTATTCCTATGCGGATGAAACCAGCCCCGAACCAACAGACACCCTGGTAATCCAAGCCGGGCAGTTCGGTGTCTTTCCGCCGGAAACCTGGCACCGGATAGAAGCGGTTACTGACGATACTGTGTTCAATGTCGATTTTTATGTCGCCCCAGAGATCCTGACCGAGGAGTAACACAATCATGAACGACGAAAACAAAGGCTTTTTATTAGAGCTGATAAATG