Homologs in group_566

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01465 FBDBKF_01465 100.0 Morganella morganii S1 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
EHELCC_00080 EHELCC_00080 100.0 Morganella morganii S2 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
LHKJJB_04895 LHKJJB_04895 100.0 Morganella morganii S3 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
HKOGLL_02150 HKOGLL_02150 100.0 Morganella morganii S5 trmN6 tRNA1(Val) A37 N6-methylase TrmN6
F4V73_RS01940 F4V73_RS01940 75.3 Morganella psychrotolerans - tRNA1(Val) (adenine(37)-N6)-methyltransferase
PMI_RS09355 PMI_RS09355 50.6 Proteus mirabilis HI4320 - tRNA1(Val) (adenine(37)-N6)-methyltransferase

Distribution of the homologs in the orthogroup group_566

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_566

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N1W7 8.06e-95 281 54 1 244 3 plu3348 tRNA1(Val) (adenine(37)-N6)-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JRB8 1.12e-91 273 52 3 253 3 YPK_1180 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667U2 1.41e-91 273 52 3 253 3 YPTB2899 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q74SR9 1.41e-91 273 52 3 253 3 YPO2709 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis
B2KA56 1.41e-91 273 52 3 253 3 YPTS_3010 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A4TKY7 1.83e-91 272 53 2 249 3 YPDSF_1562 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CKF3 1.83e-91 272 53 2 249 3 YPN_1197 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3Z3 1.83e-91 272 53 2 249 3 YpAngola_A3602 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q1C564 1.83e-91 272 53 2 249 3 YPA_2443 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFT0 1.83e-91 272 53 2 249 3 YpsIP31758_1127 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GI34 5.02e-91 272 56 2 241 3 Spro_3678 tRNA1(Val) (adenine(37)-N6)-methyltransferase Serratia proteamaculans (strain 568)
B4F055 1.76e-86 260 49 3 249 3 PMI1896 tRNA1(Val) (adenine(37)-N6)-methyltransferase Proteus mirabilis (strain HI4320)
A1JKJ4 5.25e-86 259 53 2 244 3 YE1008 tRNA1(Val) (adenine(37)-N6)-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D211 6.25e-86 258 52 1 240 3 ECA3286 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DC08 4.41e-84 254 53 1 242 3 PC1_3079 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5XNG1 1.14e-77 237 50 1 244 3 KPK_1222 tRNA1(Val) (adenine(37)-N6)-methyltransferase Klebsiella pneumoniae (strain 342)
A6TCI9 2.62e-77 236 49 1 244 3 KPN78578_28490 tRNA1(Val) (adenine(37)-N6)-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MH06 2.79e-77 236 51 1 244 3 ESA_00683 tRNA1(Val) (adenine(37)-N6)-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
C6CB42 4.1e-75 231 46 3 248 3 Dd703_2793 tRNA1(Val) (adenine(37)-N6)-methyltransferase Musicola paradisiaca (strain Ech703)
B2VI36 6.15e-75 230 48 1 244 3 ETA_09820 tRNA1(Val) (adenine(37)-N6)-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4WDE6 7.17e-75 230 50 2 246 3 Ent638_3062 tRNA1(Val) (adenine(37)-N6)-methyltransferase Enterobacter sp. (strain 638)
C6CNL2 5.71e-74 228 48 4 253 3 Dd1591_1060 tRNA1(Val) (adenine(37)-N6)-methyltransferase Dickeya chrysanthemi (strain Ech1591)
A9MGW2 3.58e-73 226 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BAS2 2.07e-72 224 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi A (strain AKU_12601)
A9N0W9 2.07e-72 224 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNB8 2.07e-72 224 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RD57 3.56e-72 223 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QTV6 3.56e-72 223 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q8ZMX8 4.33e-72 223 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0PVY6 4.33e-72 223 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella paratyphi C (strain RKS4594)
A8AD10 4.48e-72 223 46 1 244 3 CKO_00207 tRNA1(Val) (adenine(37)-N6)-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z4J9 7.47e-72 223 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella typhi
Q57L59 1.16e-71 223 47 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Salmonella choleraesuis (strain SC-B67)
Q32CU6 9.24e-71 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q3YYU0 1.81e-70 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella sonnei (strain Ss046)
Q83QI2 2.18e-70 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella flexneri
Q0T1T1 2.18e-70 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B6I5E9 2.18e-70 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain SE11)
B7M8I9 2.18e-70 219 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O8 (strain IAI1)
B1LP88 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7N6G4 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P31825 3.06e-70 218 45 1 244 1 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain K12)
B1IVQ2 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A386 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O9:H4 (strain HS)
B1XBQ2 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZYJ8 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
C6UBI3 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain B / REL606)
C5W7S9 3.06e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain B / BL21-DE3)
B7LDG8 4.15e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZQ20 4.15e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7NRM8 5.69e-70 218 47 1 236 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q31XR1 7.23e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TYI8 7.23e-70 218 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R8F7 9.91e-70 217 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli (strain UTI89 / UPEC)
Q8FF14 9.91e-70 217 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AEA5 9.91e-70 217 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O1:K1 / APEC
B7MIR0 9.91e-70 217 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH15 9.91e-70 217 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B7MYK8 1.57e-69 216 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O81 (strain ED1a)
B7LUY9 3.7e-69 216 44 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8XA22 4.08e-69 216 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O157:H7
Q0TER3 4.85e-69 215 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C6UQY1 2.11e-68 214 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O157:H7 (strain TW14359 / EHEC)
B5Z149 2.11e-68 214 45 1 244 3 yfiC tRNA1(Val) (adenine(37)-N6)-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
C5BAI6 1.49e-66 209 49 3 238 3 NT01EI_3041 tRNA1(Val) (adenine(37)-N6)-methyltransferase Edwardsiella ictaluri (strain 93-146)
C4LCN4 3.22e-65 205 44 1 233 3 Tola_0970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6VKA4 1.9e-64 203 45 2 235 3 Asuc_0019 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A6LD46 2.75e-62 198 44 3 234 3 BDI_1875 tRNA1(Val) (adenine(37)-N6)-methyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q5LCS1 3.94e-61 195 43 1 233 3 BF2394 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64TX7 4.11e-61 195 43 1 233 3 BF2305 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides fragilis (strain YCH46)
C6AQR4 3.63e-60 192 43 3 235 3 NT05HA_1847 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aggregatibacter aphrophilus (strain NJ8700)
Q65W50 7.46e-59 189 39 4 247 3 MS0203 tRNA1(Val) (adenine(37)-N6)-methyltransferase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A0KPC4 1.34e-58 188 43 1 237 3 AHA_3669 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q119M4 1.97e-58 188 42 2 235 3 Tery_0325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Trichodesmium erythraeum (strain IMS101)
Q8A9H7 2.09e-57 185 42 1 232 3 BT_0838 tRNA1(Val) (adenine(37)-N6)-methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6L532 5.46e-57 184 43 2 233 3 BVU_3164 tRNA1(Val) (adenine(37)-N6)-methyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A4SRS5 8.26e-56 181 44 1 237 3 ASA_3636 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aeromonas salmonicida (strain A449)
A5FKD7 3.28e-55 180 40 4 235 3 Fjoh_1299 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q3IG80 8.87e-55 178 41 3 234 3 PSHAa0511 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pseudoalteromonas translucida (strain TAC 125)
A5UA66 1.89e-54 177 39 3 235 3 CGSHiEE_00885 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittEE)
A6GWI6 1.97e-54 177 38 3 234 3 FP0346 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q4QNC1 4.13e-54 177 39 3 235 3 NTHI0547 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain 86-028NP)
B0UWL8 5.08e-54 177 37 2 238 3 HSM_0322 tRNA1(Val) (adenine(37)-N6)-methyltransferase Histophilus somni (strain 2336)
Q0I4T7 8.35e-54 176 36 2 238 3 HS_1296 tRNA1(Val) (adenine(37)-N6)-methyltransferase Histophilus somni (strain 129Pt)
A5UGT6 1.23e-53 176 38 3 234 3 CGSHiGG_05325 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain PittGG)
A7MXM2 1.85e-53 175 40 3 235 3 VIBHAR_00953 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
P44702 8.3e-53 173 38 3 234 3 HI_0423 tRNA1(Val) (adenine(37)-N6)-methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q87SB8 8.31e-53 174 42 3 235 3 VP0506 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15NR8 3.44e-52 173 38 5 262 3 Patl_3970 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9CJZ9 3.53e-52 172 38 2 240 3 PM1839 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pasteurella multocida (strain Pm70)
B8F678 9.61e-52 171 40 5 240 3 HAPS_1234 tRNA1(Val) (adenine(37)-N6)-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q8DEQ3 1.15e-51 171 40 3 237 3 VV1_0533 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain CMCP6)
Q7MNQ4 1.56e-51 170 40 3 237 3 VV0662 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio vulnificus (strain YJ016)
A0LXM6 1.93e-51 170 36 3 235 3 GFO_0132 tRNA1(Val) (adenine(37)-N6)-methyltransferase Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
C3LSR6 3.01e-48 162 39 3 235 3 VCM66_0619 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KU62 3.01e-48 162 39 3 235 3 VC_0661 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B6EMW5 8.19e-47 158 38 5 238 3 VSAL_I0559 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio salmonicida (strain LFI1238)
B3H2W9 1.71e-46 157 34 2 236 3 APP7_1987 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3J4 2.29e-46 157 34 2 236 3 APL_1900 tRNA1(Val) (adenine(37)-N6)-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C6VS84 1.6e-45 155 35 4 243 3 Dfer_5119 tRNA1(Val) (adenine(37)-N6)-methyltransferase Dyadobacter fermentans (strain ATCC 700827 / DSM 18053 / CIP 107007 / KCTC 52180 / NS114)
A8FRM9 3.21e-45 154 35 3 245 3 Ssed_0891 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sediminis (strain HAW-EB3)
C6Y2G0 1.52e-44 152 35 2 237 3 Phep_2972 tRNA1(Val) (adenine(37)-N6)-methyltransferase Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)
Q6LUN9 2.3e-44 152 38 2 237 3 PBPRA0563 tRNA1(Val) (adenine(37)-N6)-methyltransferase Photobacterium profundum (strain SS9)
Q087P4 8.73e-44 151 35 2 249 3 Sfri_0661 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella frigidimarina (strain NCIMB 400)
Q5E7Q6 3e-42 146 38 3 235 3 VF_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B1KF36 4.32e-42 146 34 4 247 3 Swoo_0893 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella woodyi (strain ATCC 51908 / MS32)
Q8EI95 5.73e-42 145 36 4 239 3 SO_0948 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A8H0P3 1.21e-41 145 36 5 266 3 Spea_0803 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CU29 2.86e-41 144 34 3 244 3 swp_4230 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
B7VJ58 6.1e-41 143 37 4 237 3 VS_0507 tRNA1(Val) (adenine(37)-N6)-methyltransferase Vibrio atlanticus (strain LGP32)
Q0HRP2 3.4e-40 141 35 3 236 3 Shewmr7_3230 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain MR-7)
Q0HM44 8.85e-40 140 35 3 236 3 Shewmr4_0793 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain MR-4)
A3QAZ2 3.51e-39 139 36 3 242 3 Shew_0768 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A0L0I8 3.59e-39 139 34 4 244 3 Shewana3_3333 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain ANA-3)
B5F9T8 3.65e-39 138 37 3 235 3 VFMJ11_0445 tRNA1(Val) (adenine(37)-N6)-methyltransferase Aliivibrio fischeri (strain MJ11)
B0TUD3 5.24e-39 138 35 3 245 3 Shal_0858 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella halifaxensis (strain HAW-EB4)
C6X2D2 2e-38 136 37 3 199 3 FIC_02159 tRNA1(Val) (adenine(37)-N6)-methyltransferase Flavobacteriaceae bacterium (strain 3519-10)
Q12R91 1.78e-36 132 30 3 265 3 Sden_0745 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1RN54 6.04e-36 130 33 4 238 3 Sputw3181_3285 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella sp. (strain W3-18-1)
A4Y3T4 1.5e-35 129 32 4 238 3 Sputcn32_0888 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q11RK8 2.33e-34 126 33 6 239 3 CHU_2705 tRNA1(Val) (adenine(37)-N6)-methyltransferase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A9L1L1 6.92e-34 125 32 6 248 3 Sbal195_3645 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS195)
A6WS64 7.38e-34 125 32 6 248 3 Shew185_3526 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS185)
A1S987 1.59e-33 124 34 2 234 3 Sama_2741 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3D0V3 2.05e-32 121 32 6 245 3 Sbal_0841 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E5T2 2.05e-32 121 32 6 245 3 Sbal223_3451 tRNA1(Val) (adenine(37)-N6)-methyltransferase Shewanella baltica (strain OS223)
Q7MVG0 3.04e-30 116 34 5 244 3 PG_1104 tRNA1(Val) (adenine(37)-N6)-methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RK25 1.01e-29 114 34 5 244 3 PGN_1201 tRNA1(Val) (adenine(37)-N6)-methyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8A1D7 6.64e-10 61 33 6 147 3 prmC Release factor glutamine methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q1RH40 1.97e-08 57 29 5 144 3 prmC/trmB Bifunctional methyltransferase Rickettsia bellii (strain RML369-C)
Q68VR6 3.28e-08 57 29 4 138 3 prmC/trmB Bifunctional methyltransferase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCB3 3.47e-08 57 28 4 137 3 prmC/trmB Bifunctional methyltransferase Rickettsia prowazekii (strain Madrid E)
Q9JTA1 4.2e-08 56 31 6 153 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JYC0 4.4e-08 56 31 6 153 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5F783 6.85e-08 55 31 6 153 3 prmB Ribosomal protein uL3 glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
P37543 2.56e-07 53 28 3 113 3 yabB Probable RNA methyltransferase YabB Bacillus subtilis (strain 168)
Q8ECQ4 3.65e-07 53 31 5 147 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7W022 4.2e-07 53 40 4 91 3 prmC Release factor glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7ULT2 4.4e-07 53 38 2 81 3 prmC Release factor glutamine methyltransferase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8DHV7 5.76e-07 52 32 6 153 3 prmC Release factor glutamine methyltransferase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P39199 6.72e-07 52 39 3 84 1 prmB Ribosomal protein uL3 glutamine methyltransferase Escherichia coli (strain K12)
Q63SZ9 7.3e-07 52 37 2 83 3 prmB Ribosomal protein uL3 glutamine methyltransferase Burkholderia pseudomallei (strain K96243)
Q8DPZ3 1e-06 52 37 3 87 3 prmC Release factor glutamine methyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P39200 1.05e-06 52 32 5 121 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio anguillarum (strain ATCC 68554 / 775)
Q9CNN7 1.26e-06 52 31 3 116 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pasteurella multocida (strain Pm70)
P74003 1.37e-06 52 33 5 132 3 prmC Release factor glutamine methyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8KCD5 2.31e-06 51 33 5 133 3 prmC Release factor glutamine methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q32DK7 2.35e-06 51 38 3 84 3 prmB Ribosomal protein uL3 glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q2S0V8 2.5e-06 51 41 4 86 3 prmC Release factor glutamine methyltransferase Salinibacter ruber (strain DSM 13855 / M31)
Q9KQ83 3.61e-06 50 36 3 84 3 prmB Ribosomal protein uL3 glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9PDL1 3.79e-06 50 32 3 96 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
P0A293 4.1e-06 50 36 2 84 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A294 4.1e-06 50 36 2 84 3 prmB Ribosomal protein uL3 glutamine methyltransferase Salmonella typhi
Q92G13 4.57e-06 50 29 5 136 3 prmC/trmB Bifunctional methyltransferase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UJU4 5.45e-06 50 31 4 107 3 prmC/trmB Bifunctional methyltransferase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q89DG5 5.65e-06 50 33 7 133 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q87DS5 6.98e-06 49 32 3 96 3 prmB Ribosomal protein uL3 glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q0WDE1 9.77e-06 49 37 2 80 3 prmB Ribosomal protein uL3 glutamine methyltransferase Yersinia pestis
Q98G94 1.24e-05 48 38 2 85 3 prmC Release factor glutamine methyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9PD67 1.27e-05 48 34 4 121 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain 9a5c)
Q5E3U5 1.62e-05 48 35 3 84 3 prmB Ribosomal protein uL3 glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6H162 1.64e-05 48 34 5 98 3 prmC Release factor glutamine methyltransferase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q921L7 2e-05 48 37 2 83 2 Hemk1 MTRF1L release factor glutamine methyltransferase Mus musculus
Q87DF7 2.21e-05 48 34 4 121 3 prmC Release factor glutamine methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q32GZ5 3.14e-05 47 40 4 89 3 prmC Release factor glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q1II29 3.71e-05 47 36 3 87 3 prmC Release factor glutamine methyltransferase Koribacter versatilis (strain Ellin345)
Q0A793 4.28e-05 47 33 3 98 3 rlmL Ribosomal RNA large subunit methyltransferase K/L Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q7VXJ6 4.44e-05 47 37 2 82 3 prmB Ribosomal protein uL3 glutamine methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q748B2 5.01e-05 47 32 6 137 3 prmC Release factor glutamine methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
P45106 5.23e-05 47 35 2 81 3 prmB Ribosomal protein uL3 glutamine methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q81JX2 7.03e-05 46 23 7 197 3 prmC Release factor glutamine methyltransferase Bacillus anthracis
Q814U1 7.63e-05 46 23 6 179 3 prmC Release factor glutamine methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q9CHX0 7.7e-05 46 36 3 86 3 prmC Release factor glutamine methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
P40816 0.000105 46 31 8 154 3 prmC Release factor glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9WBM9 0.000115 45 40 3 79 3 prmC Release factor glutamine methyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q83AD8 0.000124 45 37 3 87 3 prmC Release factor glutamine methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q8DBY0 0.000129 46 31 5 122 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio vulnificus (strain CMCP6)
Q7MHY6 0.000135 45 31 4 113 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio vulnificus (strain YJ016)
Q87LY1 0.000137 45 31 5 122 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9I347 0.000149 45 36 3 88 3 prmB Ribosomal protein uL3 glutamine methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0ACC2 0.000152 45 39 4 89 3 prmC Release factor glutamine methyltransferase Shigella flexneri
P0ACC1 0.000152 45 39 4 89 1 prmC Release factor glutamine methyltransferase Escherichia coli (strain K12)
P45873 0.000171 45 34 4 83 3 prmC Release factor glutamine methyltransferase Bacillus subtilis (strain 168)
Q5F5B4 0.000184 45 39 5 86 3 prmC Release factor glutamine methyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q5E6T2 0.000286 44 35 4 90 3 prmC Release factor glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8EAR4 0.000304 44 35 3 92 3 prmC Release factor glutamine methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q9KQ26 0.000324 44 33 3 84 3 prmC Release factor glutamine methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A7MUT5 0.00033 44 31 5 122 3 rsmC Ribosomal RNA small subunit methyltransferase C Vibrio campbellii (strain ATCC BAA-1116)
Q8PC99 0.000375 44 36 2 83 3 prmC Release factor glutamine methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q7CIA2 0.000441 44 38 5 97 3 prmC Release factor glutamine methyltransferase Yersinia pestis
Q9K4E3 0.000574 43 29 9 173 3 prmC Release factor glutamine methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q831F7 0.000593 43 23 6 147 3 prmC Release factor glutamine methyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q9A9T7 0.000856 43 34 3 88 3 prmC Release factor glutamine methyltransferase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P65347 0.001 42 38 4 76 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 0.001 42 38 4 76 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 0.001 42 38 4 76 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_03380
Feature type CDS
Gene trmN6
Product tRNA1(Val) A37 N6-methylase TrmN6
Location 662868 - 663611 (strand: -1)
Length 744 (nucleotides) / 247 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_566
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05175 Methyltransferase small domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4123 Translation, ribosomal structure and biogenesis (J) J tRNA1(Val) A37 N6-methylase TrmN6

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K15460 tRNA1Val (adenine37-N6)-methyltransferase [EC:2.1.1.223] - -

Protein Sequence

MMTNEKQSPRRRGFACKQFFVAHDRCAMKVGTDGVLLGGWAPCENARHILDIGTGSGLVALMLAQRSLPDTPIDAVDIDADAAAQAAENFLASPWGGRMKVFHQDIGEFTAACPQSRYELIVSNPPYFAPAVACRNSARETARYTTSLDHPQLLEHAAQLITPDGLLCVVLPYTTGQDFIAAAGEQNWFLHTQIAVSDKPDTPFHRTLIALSRRPVSALHKTMSIKTEEGRYSADFKSFITGFYLKY

Flanking regions ( +/- flanking 50bp)

CGTATCCTGTCGCCGGGATTTCTTTATTTTAACAGACAAACAGTTCCGTGATGATGACAAACGAAAAACAATCGCCGCGCCGCCGTGGTTTTGCCTGCAAACAATTTTTTGTGGCCCATGACCGCTGTGCCATGAAAGTCGGTACTGACGGGGTGCTGCTCGGCGGCTGGGCACCGTGCGAAAATGCCCGCCATATTCTGGATATCGGTACCGGCAGCGGGCTGGTGGCGCTGATGCTGGCTCAGCGGTCATTGCCGGATACACCGATTGATGCGGTGGATATTGATGCTGACGCCGCAGCGCAGGCCGCAGAGAATTTCCTCGCGTCACCGTGGGGTGGCCGGATGAAGGTGTTTCATCAGGATATCGGTGAGTTTACCGCTGCCTGCCCGCAATCCCGTTATGAGCTTATCGTCAGTAATCCGCCGTATTTCGCCCCGGCGGTCGCCTGCCGTAACAGTGCCCGGGAAACCGCCCGTTACACCACATCACTGGATCACCCTCAGTTGCTGGAGCATGCGGCACAGCTTATCACGCCGGACGGTCTGCTCTGTGTGGTGCTGCCGTACACCACAGGACAGGATTTTATCGCTGCCGCCGGTGAGCAGAACTGGTTTCTGCACACACAGATTGCCGTGTCAGATAAACCGGATACCCCTTTTCACCGGACATTAATCGCCTTATCGCGCCGTCCGGTCAGTGCGCTGCACAAAACGATGAGTATTAAAACGGAAGAGGGCCGTTACAGCGCTGATTTCAAATCATTTATCACCGGTTTTTATCTGAAATACTGAACTGCGTCACTGTGGCGGTTACGGTGGTGCTTTTTTCAGTCAAAAGCGGA