Homologs in group_511

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01055 FBDBKF_01055 100.0 Morganella morganii S1 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
EHELCC_00490 EHELCC_00490 100.0 Morganella morganii S2 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
LHKJJB_04485 LHKJJB_04485 100.0 Morganella morganii S3 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
HKOGLL_02560 HKOGLL_02560 100.0 Morganella morganii S5 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
F4V73_RS07130 F4V73_RS07130 95.2 Morganella psychrotolerans ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
PMI_RS09105 PMI_RS09105 93.0 Proteus mirabilis HI4320 ispG flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase

Distribution of the homologs in the orthogroup group_511

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_511

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZT3 0.0 702 93 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Proteus mirabilis (strain HI4320)
P72241 0.0 701 94 0 362 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Providencia stuartii
Q7N706 0.0 694 90 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GHW5 0.0 684 89 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Serratia proteamaculans (strain 568)
Q6D276 0.0 683 88 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1JKS2 0.0 681 88 0 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DBH4 0.0 680 88 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VE89 0.0 671 87 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B1JS05 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667Z9 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CK91 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis bv. Antiqua (strain Nepal516)
A9R802 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis bv. Antiqua (strain Angola)
P58672 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis
B2K9Q0 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C5I8 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFY9 0.0 668 88 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TMT7 0.0 667 87 0 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Yersinia pestis (strain Pestoides F)
B7LKC3 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R8L8 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain UTI89 / UPEC)
B6I587 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain SE11)
P62620 0.0 667 87 1 373 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain K12)
B1IWE6 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P62621 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEX0 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE53 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O1:K1 / APEC
B1XAZ0 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain K12 / DH10B)
C4ZX90 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain K12 / MC4100 / BW2952)
B7MYF0 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O81 (strain ED1a)
B7NRG5 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0Y4 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O157:H7 (strain EC4115 / EHEC)
P62622 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O157:H7
B7LDA7 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain 55989 / EAEC)
B7MI00 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGW1 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPV8 0.0 667 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O139:H28 (strain E24377A / ETEC)
Q7MNF1 0.0 666 87 0 370 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio vulnificus (strain YJ016)
Q8DEZ8 0.0 666 87 0 370 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio vulnificus (strain CMCP6)
B1LNH0 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli (strain SMS-3-5 / SECEC)
A7MGV7 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Cronobacter sakazakii (strain ATCC BAA-894)
Q9KTX1 0.0 665 87 0 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q3YZ37 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella sonnei (strain Ss046)
Q31XX5 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella boydii serotype 4 (strain Sb227)
B7N6A3 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A8A321 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O9:H4 (strain HS)
B7M7L9 0.0 665 87 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Escherichia coli O8 (strain IAI1)
A6TCD4 0.0 664 87 1 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q83K43 0.0 663 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella flexneri
Q0T204 0.0 663 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella flexneri serotype 5b (strain 8401)
Q32D47 0.0 663 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella dysenteriae serotype 1 (strain Sd197)
Q87S16 0.0 662 86 0 370 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q2NS40 0.0 661 86 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sodalis glossinidius (strain morsitans)
B5F198 0.0 661 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella agona (strain SL483)
B5XNL5 0.0 660 86 1 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Klebsiella pneumoniae (strain 342)
P58671 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P58670 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella typhi
B5BAY5 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella paratyphi A (strain AKU_12601)
Q5PNI2 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T0P9 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella newport (strain SL254)
B4TD93 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella heidelberg (strain SL476)
B5R582 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella enteritidis PT4 (strain P125109)
B5FR63 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella dublin (strain CT_02021853)
Q57LI6 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella choleraesuis (strain SC-B67)
A7MU42 0.0 660 87 0 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio campbellii (strain ATCC BAA-1116)
B2TXU0 0.0 660 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q6LU49 0.0 659 86 0 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Photobacterium profundum (strain SS9)
B4TR95 0.0 659 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella schwarzengrund (strain CVM19633)
A8AD71 0.0 659 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MHL5 0.0 659 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7VJT8 0.0 658 86 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vibrio atlanticus (strain LGP32)
A9N201 0.0 658 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RCZ2 0.0 658 86 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5FAX2 0.0 658 85 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aliivibrio fischeri (strain MJ11)
A4WD93 0.0 657 85 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Enterobacter sp. (strain 638)
Q5E772 0.0 655 85 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6EGY7 0.0 646 83 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aliivibrio salmonicida (strain LFI1238)
B4RV89 0.0 642 85 0 370 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8H245 0.0 642 86 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLI4 0.0 638 85 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella halifaxensis (strain HAW-EB4)
B8CKR1 0.0 633 85 0 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella piezotolerans (strain WP3 / JCM 13877)
P57987 0.0 632 85 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pasteurella multocida (strain Pm70)
P44667 0.0 630 86 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGH1 0.0 630 85 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain PittGG)
Q4QNH4 0.0 629 85 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain 86-028NP)
Q8EC32 0.0 627 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KXK8 0.0 627 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS195)
A6WQP7 0.0 627 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS185)
A3D6V9 0.0 627 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9S7 0.0 627 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella baltica (strain OS223)
A3QCG2 0.0 627 83 0 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q65R84 0.0 627 85 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1RHQ3 0.0 626 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain W3-18-1)
A4Y8U0 0.0 626 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1S863 0.0 626 83 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0HX57 0.0 626 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain MR-7)
Q0HKV9 0.0 626 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain MR-4)
A0KUJ5 0.0 626 82 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sp. (strain ANA-3)
A6VQX6 0.0 626 83 1 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VME2 0.0 625 83 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q12PT4 0.0 624 81 1 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0USG8 0.0 624 84 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Histophilus somni (strain 2336)
Q0I2E9 0.0 624 84 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Histophilus somni (strain 129Pt)
Q085U6 0.0 623 82 1 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella frigidimarina (strain NCIMB 400)
A8FT70 0.0 622 82 1 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella sediminis (strain HAW-EB3)
B0BQB9 0.0 622 83 1 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY64 0.0 622 83 1 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N1H8 0.0 622 83 1 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B1KKJ2 0.0 619 80 1 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shewanella woodyi (strain ATCC 51908 / MS32)
C4K4I8 0.0 618 81 1 369 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q47WC0 0.0 602 78 1 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3ICZ5 0.0 592 77 0 372 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudoalteromonas translucida (strain TAC 125)
Q1LU77 0.0 588 77 0 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Baumannia cicadellinicola subsp. Homalodisca coagulata
A1SU39 0.0 585 78 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5QYA9 0.0 583 77 1 368 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A5UAB9 0.0 582 88 0 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Haemophilus influenzae (strain PittEE)
Q492E0 0.0 546 71 2 367 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Blochmanniella pennsylvanica (strain BPEN)
Q1QTK8 0.0 541 73 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6V0W0 0.0 529 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain PA7)
Q9HXJ4 0.0 528 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02RV7 0.0 528 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UWI8 0.0 528 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas aeruginosa (strain LESB58)
Q886Z0 0.0 527 73 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K7B6 0.0 525 72 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas fluorescens (strain Pf0-1)
Q4K6U9 0.0 525 72 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B0KPI7 0.0 523 73 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain GB-1)
B3PDM1 0.0 523 71 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Cellvibrio japonicus (strain Ueda107)
B1JDV8 0.0 522 73 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain W619)
Q48LZ4 0.0 522 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A4XY32 0.0 521 72 1 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas mendocina (strain ymp)
A1TZQ0 0.0 520 70 1 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q88PJ7 0.0 519 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5VYT5 0.0 518 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IEI1 0.0 518 73 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas entomophila (strain L48)
Q4ZX23 0.0 518 72 2 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas syringae pv. syringae (strain B728a)
Q2SDW4 0.0 518 69 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hahella chejuensis (strain KCTC 2396)
C1DE57 0.0 518 71 1 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C3K1L4 0.0 515 72 2 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudomonas fluorescens (strain SBW25)
A6VV06 0.0 513 67 1 362 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Marinomonas sp. (strain MWYL1)
B5EJF3 0.0 513 69 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JC30 0.0 513 69 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q21KT3 0.0 511 69 1 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8K9P4 0.0 511 66 0 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57374 0.0 510 64 1 366 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8D1Y3 1.54e-172 488 64 0 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wigglesworthia glossinidia brevipalpis
A1AW46 4.33e-171 484 64 2 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruthia magnifica subsp. Calyptogena magnifica
Q6FEM3 4.16e-169 479 65 2 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0V5G7 2.56e-168 477 64 1 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain AYE)
A3M211 2.56e-168 477 64 1 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VKR8 2.56e-168 477 64 1 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain SDF)
B2I3E5 2.56e-168 477 64 1 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain ACICU)
B7I5G7 2.56e-168 477 64 1 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain AB0057)
B7H069 2.56e-168 477 64 1 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acinetobacter baumannii (strain AB307-0294)
A5CX35 3.65e-164 466 62 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0VNE0 6.06e-164 466 63 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1QD18 1.02e-152 437 63 2 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FTW7 1.02e-152 437 63 2 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A0LDN3 7.87e-143 412 61 1 333 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q9A9W0 3.95e-140 406 57 0 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A9HJ48 4.85e-138 401 58 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q1GIC1 1.16e-136 397 58 0 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruegeria sp. (strain TM1040)
Q0C4J3 1.25e-136 397 56 0 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hyphomonas neptunium (strain ATCC 15444)
Q4FNA0 8.64e-136 394 54 2 357 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pelagibacter ubique (strain HTCC1062)
Q5FUR7 1.6e-135 394 58 3 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Gluconobacter oxydans (strain 621H)
Q28R10 5.3e-135 393 56 0 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Jannaschia sp. (strain CCS1)
Q0BUK0 5.35e-134 391 57 0 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
A5FX97 6.55e-133 387 59 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidiphilium cryptum (strain JF-5)
Q5NR50 1.4e-132 387 60 0 316 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2RWE4 3.08e-132 386 56 2 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q74D60 3.85e-131 382 54 2 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A8LI72 2.36e-130 381 58 0 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q67PA7 1.86e-127 374 50 1 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A1B323 3.48e-127 373 58 0 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Paracoccus denitrificans (strain Pd 1222)
Q5LQ99 6.4e-127 372 58 0 350 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B5YIQ4 1.85e-120 355 49 1 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
P58667 3.67e-120 354 51 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clostridium perfringens (strain 13 / Type A)
Q8RA30 1.58e-118 350 53 1 328 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q1MSE5 2.24e-118 350 49 1 342 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Lawsonia intracellularis (strain PHE/MN1-00)
Q8RG40 2.83e-117 347 51 0 324 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A7GSX5 3.43e-117 347 49 1 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q97I56 3.23e-116 344 50 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A9VH61 5.44e-116 344 52 0 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus mycoides (strain KBAB4)
B7IYD0 7.39e-116 344 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain G9842)
B9IY45 8.06e-116 344 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain Q1)
Q730Q8 8.06e-116 344 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain ATCC 10987 / NRS 248)
B7HPH8 9.81e-116 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain AH187)
Q9KD18 1.07e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q818H8 2.06e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HCQ3 2.06e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain B4264)
Q6HDN9 2.4e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus thuringiensis subsp. konkukian (strain 97-27)
C1ES01 2.4e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain 03BB102)
B7JN03 2.4e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain AH820)
A0RIQ2 2.4e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus thuringiensis (strain Al Hakam)
C3LKV7 2.4e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8I5 2.4e-115 343 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus anthracis (strain A0248)
Q81LV7 2.5e-115 342 52 0 325 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus anthracis
C5D4Q3 2.97e-115 342 52 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacillus sp. (strain WCH70)
Q634Q9 3.55e-115 342 52 0 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus cereus (strain ZK / E33L)
B1HSS4 1.34e-114 341 48 2 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Lysinibacillus sphaericus (strain C3-41)
B8I6E1 1.34e-114 340 50 0 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q895K3 7.99e-114 338 47 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clostridium tetani (strain Massachusetts / E88)
A4IQZ4 1.26e-113 338 51 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacillus thermodenitrificans (strain NG80-2)
Q6AP32 1.94e-113 338 48 1 335 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q5KX35 4.69e-113 337 51 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Geobacillus kaustophilus (strain HTA426)
Q5WHB2 8.08e-113 336 52 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Shouchella clausii (strain KSM-K16)
A7Z6S2 9.01e-113 336 51 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B7GH89 9.71e-113 336 50 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B9E6U1 1.14e-112 336 49 2 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Macrococcus caseolyticus (strain JCSC5402)
Q72CD9 1.55e-112 336 52 1 335 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q71ZM9 2.73e-112 335 51 1 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Listeria monocytogenes serotype 4b (strain F2365)
C1L2Z7 3.4e-112 335 51 1 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Listeria monocytogenes serotype 4b (strain CLIP80459)
A8FF87 3.51e-112 335 51 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus pumilus (strain SAFR-032)
P54482 4.09e-112 335 51 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus subtilis (strain 168)
Q65HA9 4.56e-112 334 51 1 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
C6BYK9 1.38e-111 333 49 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
P58668 3.19e-111 332 49 2 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
C4L3K5 1.54e-110 330 48 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A4XLZ4 3.31e-109 326 48 1 309 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A6Q1U2 6.23e-109 326 52 2 318 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitratiruptor sp. (strain SB155-2)
C0ZF58 8.2e-108 323 48 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q30TM4 1.48e-107 322 52 2 320 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A5FS85 1.57e-107 322 46 2 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B1YLA2 2.04e-107 322 48 0 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q3ZZC9 5.1e-107 321 46 2 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dehalococcoides mccartyi (strain CBDB1)
B2V7Y2 1.02e-106 320 45 1 348 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sulfurihydrogenibium sp. (strain YO3AOP1)
A6QC65 1.86e-106 319 52 2 317 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sulfurovum sp. (strain NBC37-1)
B2A390 2.94e-105 317 44 2 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
C0QRI5 3.9e-105 316 47 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Persephonella marina (strain DSM 14350 / EX-H1)
Q8G7Y6 1.75e-104 316 47 2 335 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bifidobacterium longum (strain NCC 2705)
Q82K43 5.16e-104 314 46 1 327 3 ispG1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q47RY0 3.2e-103 312 45 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermobifida fusca (strain YX)
O67496 3.39e-102 309 46 1 348 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aquifex aeolicus (strain VF5)
B9LA27 3.92e-102 308 50 2 318 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q9X7W2 1.31e-101 308 43 1 353 3 ispG1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KYR9 1.56e-101 308 45 1 327 3 ispG2 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A1R501 1.6e-101 308 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Paenarthrobacter aurescens (strain TC1)
A8L6E2 1.66e-101 308 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Parafrankia sp. (strain EAN1pec)
B8HG44 4.03e-101 307 45 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
Q6A7L2 5.62e-101 306 47 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q5YS74 1.13e-100 306 44 1 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nocardia farcinica (strain IFM 10152)
A0JUS8 1.53e-100 305 44 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Arthrobacter sp. (strain FB24)
Q82ML3 1.62e-100 305 43 2 358 3 ispG2 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A8M723 4.28e-100 305 45 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salinispora arenicola (strain CNS-205)
B5Z6Z7 6.03e-100 303 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain G27)
Q1CTP7 8.17e-100 303 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain HPAG1)
O25342 8.26e-100 303 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain ATCC 700392 / 26695)
B1VGA4 9.48e-100 303 47 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
B6JLL3 1.86e-99 302 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain P12)
B2UTK0 4.3e-99 301 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain Shi470)
A9WR14 5.89e-99 301 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q9ZLL0 6.28e-99 300 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter pylori (strain J99 / ATCC 700824)
Q6NGL3 1.19e-98 301 44 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q0RDR2 5.2e-98 299 47 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
A5CT01 6.62e-98 298 45 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
P9WKG3 8.9e-98 298 44 1 356 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKG2 8.9e-98 298 44 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U6M2 8.9e-98 298 44 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AFY4 8.9e-98 298 44 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KML3 8.9e-98 298 44 1 356 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium bovis (strain BCG / Pasteur 1173P2)
B2GKS3 8.99e-98 298 44 2 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B0RDZ5 1.18e-97 298 43 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Clavibacter sepedonicus
Q7TXN6 1.47e-97 298 44 1 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A0LV34 1.85e-97 298 44 2 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q83N18 2.21e-97 297 42 1 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Tropheryma whipplei (strain Twist)
Q83NE4 2.21e-97 297 42 1 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Tropheryma whipplei (strain TW08/27)
A4X4L9 2.28e-97 298 44 1 344 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B1VYP5 2.94e-97 297 44 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q4JV28 3.27e-97 297 44 1 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium jeikeium (strain K411)
C1B2V4 3.94e-97 296 45 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodococcus opacus (strain B4)
Q8FP82 5.27e-97 296 44 2 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B4U9V3 6.49e-97 295 44 0 344 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Hydrogenobaculum sp. (strain Y04AAS1)
Q8NP12 6.84e-97 296 46 2 327 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q6AEX9 6.97e-97 296 44 1 331 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leifsonia xyli subsp. xyli (strain CTCB07)
Q2J717 2.16e-96 295 46 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q7VI04 3.49e-96 293 47 2 315 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter hepaticus (strain ATCC 51449 / 3B1)
A8F4Y8 9.11e-95 289 44 3 322 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q73VS3 1.13e-93 288 43 1 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B7IFY1 2.93e-93 285 42 3 318 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermosipho africanus (strain TCF52B)
Q17XU2 1.85e-92 284 47 3 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Helicobacter acinonychis (strain Sheeba)
Q8EUI6 4.97e-90 278 42 1 325 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Malacoplasma penetrans (strain HF-2)
Q9CBU5 1.96e-88 275 44 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium leprae (strain TN)
B8ZRU5 1.96e-88 275 44 1 326 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycobacterium leprae (strain Br4923)
B1LC43 3.55e-88 272 43 5 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermotoga sp. (strain RQ2)
A5IIP2 3.55e-88 272 43 5 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9WZZ3 5.03e-88 272 44 5 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A7H4D8 2.94e-87 270 40 3 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FLB6 1.3e-86 269 40 3 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A1VZ41 2.82e-86 268 40 3 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PPM1 2.92e-86 268 40 3 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q5HV95 4.22e-86 268 40 3 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter jejuni (strain RM1221)
B9KD64 2.03e-85 266 42 2 319 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q7M8Z2 2.79e-85 265 46 2 314 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q7NBH3 4.54e-85 265 41 1 316 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
A7ZCT9 2.57e-84 263 43 3 341 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter concisus (strain 13826)
A7GZ54 2.65e-84 263 43 3 347 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter curvus (strain 525.92)
A0RPL8 2.74e-80 253 42 2 318 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Campylobacter fetus subsp. fetus (strain 82-40)
B0C6E1 1.31e-76 245 39 8 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Acaryochloris marina (strain MBIC 11017)
P73672 4.84e-75 241 37 8 391 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B1WQF1 1.75e-74 239 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Crocosphaera subtropica (strain ATCC 51142 / BH68)
B7KJJ4 5.72e-74 238 38 8 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Gloeothece citriformis (strain PCC 7424)
B2J1G1 7.41e-74 238 38 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q10W70 8.88e-74 238 38 9 359 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Trichodesmium erythraeum (strain IMS101)
B0JJJ8 1.39e-73 237 39 9 357 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
P58666 2.08e-73 236 39 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B1XHZ7 3.02e-73 236 38 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q3MG27 3.26e-73 236 39 8 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q3AK30 3.88e-73 236 40 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain CC9605)
B7K5R5 1.19e-72 234 37 9 362 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Rippkaea orientalis (strain PCC 8801 / RF-1)
B8HSI6 1.29e-72 234 38 8 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q8DK70 2.52e-72 234 38 8 355 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q73N90 1.13e-71 231 38 4 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q2JS69 2.6e-71 231 40 10 354 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain JA-3-3Ab)
O83460 2.98e-71 231 40 3 330 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Treponema pallidum (strain Nichols)
Q7VBS7 3.23e-71 231 38 8 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q7V215 8.29e-71 230 38 7 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q3AXP3 1.07e-70 229 40 9 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain CC9902)
Q0I9J4 1.53e-70 229 39 10 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain CC9311)
Q2JPZ9 4.76e-69 225 37 11 390 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain JA-2-3B'a(2-13))
Q7U712 7.57e-69 224 39 9 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Parasynechococcus marenigrum (strain WH8102)
Q5N3W3 1.2e-68 224 36 8 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QC4 1.2e-68 224 36 8 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q7NFA4 1.83e-65 216 36 8 345 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7V7G9 2.44e-65 216 38 9 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin) Prochlorococcus marinus (strain MIT 9313)
Q604Q5 2.13e-60 203 36 10 375 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9RXC9 3.72e-60 203 36 11 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1H0U9 3.06e-59 200 37 14 383 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q04UL2 3.48e-59 206 41 7 282 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q04UL2 1.76e-13 75 36 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q04YW2 3.63e-59 206 41 7 282 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04YW2 1.78e-13 75 36 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q72TR2 5e-59 205 42 7 283 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q72TR2 8.2e-15 79 38 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8F1H5 5.31e-59 205 42 7 282 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q8F1H5 8.66e-15 79 38 3 106 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q1IRS5 6.27e-59 199 36 12 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Koribacter versatilis (strain Ellin345)
A5ETI5 1.73e-58 198 35 12 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q7UWC8 2.95e-58 196 37 11 338 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q84GJ3 3.18e-58 197 37 11 372 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermus thermophilus
Q72H18 3.18e-58 197 37 11 372 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A9IYW1 1.78e-57 195 35 11 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q6G1X4 1.83e-57 195 35 10 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4YKQ8 2.72e-57 195 34 12 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bradyrhizobium sp. (strain ORS 278)
Q5SLI8 3.08e-57 194 37 11 372 1 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q6G104 8.18e-57 194 35 11 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella quintana (strain Toulouse)
B6JA27 1.79e-56 193 36 15 386 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B4RMG4 1.12e-55 191 34 11 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria gonorrhoeae (strain NCCP11945)
Q5F913 1.12e-55 191 34 11 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B2FL74 1.13e-55 191 34 9 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Stenotrophomonas maltophilia (strain K279a)
A1KUD8 2.18e-55 190 34 10 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JU34 2.3e-55 190 34 10 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZN8 2.3e-55 190 34 10 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup C (strain 053442)
Q9JZ40 2.93e-55 190 34 10 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B2SG03 4.34e-55 189 35 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. mediasiatica (strain FSC147)
Q3SVD0 5.11e-55 189 34 11 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q89VV9 6.02e-55 189 34 9 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B3QBC6 6.81e-55 189 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain TIE-1)
Q5P7B3 7.15e-55 189 35 9 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6NCF3 8.92e-55 189 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0AE42 1e-54 188 36 9 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0BMA6 1.99e-54 187 34 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. holarctica (strain OSU18)
Q9PKY3 2.56e-54 191 41 8 281 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia muridarum (strain MoPn / Nigg)
Q9PKY3 3.21e-10 65 36 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia muridarum (strain MoPn / Nigg)
P58669 3.39e-54 187 35 11 382 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A3NA54 3.66e-54 187 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain 668)
Q63UT3 3.86e-54 187 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain K96243)
A3NVX1 3.86e-54 187 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain 1106a)
A1V4K1 3.86e-54 187 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain SAVP1)
A2S2A2 3.86e-54 187 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain NCTC 10229)
A3MK75 3.86e-54 187 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain NCTC 10247)
Q1QQI9 3.93e-54 187 34 10 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B4SRZ0 6.54e-54 186 34 10 374 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Stenotrophomonas maltophilia (strain R551-3)
Q3JRQ3 7.75e-54 186 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia pseudomallei (strain 1710b)
Q62JW4 7.75e-54 186 37 13 349 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia mallei (strain ATCC 23344)
A0Q6U8 1.37e-53 185 34 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. novicida (strain U112)
Q5NH64 1.45e-53 185 34 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14IL6 1.45e-53 185 34 9 353 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Francisella tularensis subsp. tularensis (strain FSC 198)
Q21C20 1.51e-53 186 34 13 386 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain BisB18)
B2U9U9 1.56e-53 186 36 13 387 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ralstonia pickettii (strain 12J)
Q2J2S7 1.72e-53 185 34 13 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain HaA2)
B4EAW9 1.73e-53 186 37 10 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B0B9G5 2.46e-53 189 41 7 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B0B9G5 6.67e-10 64 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
O84060 4.12e-53 188 41 7 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
O84060 4.84e-10 64 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KMW4 4.53e-53 188 41 7 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
Q3KMW4 4.79e-10 64 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BB44 4.67e-53 188 41 7 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0BB44 6.67e-10 64 34 0 75 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B2IE63 6.5e-53 184 35 12 373 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q47BR6 9.42e-53 183 33 13 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Dechloromonas aromatica (strain RCB)
Q7NS88 1.72e-52 182 35 13 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2P3M7 5.43e-52 181 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1UR54 6.96e-52 181 36 10 362 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q82XV0 8.31e-52 181 35 10 364 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5H0N8 9.69e-52 181 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q07V91 1.01e-51 181 33 13 384 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhodopseudomonas palustris (strain BisA53)
Q7W6P6 2.14e-51 180 35 12 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHN0 2.14e-51 180 35 12 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q9PAE3 2.26e-51 179 34 10 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xylella fastidiosa (strain 9a5c)
Q6MD85 2.59e-51 184 42 7 272 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Protochlamydia amoebophila (strain UWE25)
Q6MD85 1.85e-12 72 28 1 131 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Protochlamydia amoebophila (strain UWE25)
Q7VWL0 2.93e-51 179 35 12 361 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B1YR44 3.29e-51 179 36 10 346 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Burkholderia ambifaria (strain MC40-6)
Q8P9R7 4.9e-51 179 34 13 375 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RTS9 4.9e-51 179 34 13 375 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas campestris pv. campestris (strain B100)
Q4UTW8 4.9e-51 179 34 13 375 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas campestris pv. campestris (strain 8004)
A6WXY9 1.14e-50 178 34 11 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8YJ17 1.69e-50 177 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RF32 1.69e-50 177 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella melitensis biotype 2 (strain ATCC 23457)
Q57BA5 1.71e-50 177 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella abortus biovar 1 (strain 9-941)
Q2YLG4 1.71e-50 177 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella abortus (strain 2308)
B2S7K6 1.71e-50 177 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella abortus (strain S19)
Q8FYT2 1.8e-50 177 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella suis biovar 1 (strain 1330)
Q3BUK3 2.25e-50 177 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A9M820 2.47e-50 177 34 10 363 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q87A73 2.82e-50 177 34 10 360 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A9WWQ2 3.05e-50 176 34 11 379 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Brucella suis (strain ATCC 23445 / NCTC 10510)
Q8PLJ8 3.09e-50 177 34 13 371 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Xanthomonas axonopodis pv. citri (strain 306)
Q6K8J4 3.52e-50 182 40 6 273 2 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Oryza sativa subsp. japonica
Q6K8J4 1.11e-09 63 29 2 107 2 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Oryza sativa subsp. japonica
C3MAL6 6.35e-50 176 34 11 377 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q029T9 9.05e-50 175 38 13 358 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Solibacter usitatus (strain Ellin6076)
Q8KG23 1.37e-49 181 39 7 282 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q8KG23 2.14e-17 87 31 3 173 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B3PR71 9.83e-49 172 33 11 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium etli (strain CIAT 652)
F4K0E8 1.94e-48 177 40 6 272 1 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Arabidopsis thaliana
F4K0E8 4.39e-08 58 28 2 100 1 ISPG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic Arabidopsis thaliana
Q254D2 3.03e-48 175 38 6 292 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia felis (strain Fe/C-56)
Q254D2 5.16e-11 67 29 3 128 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia felis (strain Fe/C-56)
Q823I7 5.76e-48 174 38 5 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q823I7 1.61e-10 66 30 2 111 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q2K333 2.4e-47 169 33 10 377 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q5L669 6.7e-47 171 37 5 280 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia abortus (strain DSM 27085 / S26/3)
Q5L669 6.68e-12 70 31 2 111 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia abortus (strain DSM 27085 / S26/3)
Q7MVT7 9.1e-47 171 36 6 302 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q7MVT7 2.39e-08 59 31 3 109 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q9Z8H0 1.57e-46 171 38 5 285 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia pneumoniae
Q9Z8H0 6.61e-12 70 31 2 111 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Chlamydia pneumoniae
A6L089 2.07e-46 170 38 7 292 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6L089 3.47e-09 62 27 5 144 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6UE79 8.87e-46 165 33 10 336 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Sinorhizobium medicae (strain WSM419)
Q5PAJ1 1.33e-45 164 32 13 376 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Anaplasma marginale (strain St. Maries)
Q1MAC5 3.27e-45 163 31 11 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZUA0 3.79e-45 163 31 11 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8A4T0 4.26e-45 167 37 6 285 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8A4T0 6.81e-09 61 28 5 140 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q92L19 6.05e-45 162 33 10 336 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium meliloti (strain 1021)
P58665 1.05e-44 162 31 11 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Agrobacterium fabrum (strain C58 / ATCC 33970)
A6LGR5 1.68e-44 165 36 8 321 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A6LGR5 1.12e-10 66 31 4 135 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q98FG0 1.85e-44 161 34 12 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3YRZ7 2.54e-44 161 31 11 380 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ehrlichia canis (strain Jake)
Q5L7W2 3.56e-44 164 35 7 308 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q5L7W2 2.89e-08 59 29 2 108 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B9JE02 4.92e-44 160 30 11 352 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B9JV07 5.93e-44 160 31 12 355 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q64N34 6.52e-44 164 35 7 308 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain YCH46)
Q64N34 1.96e-08 59 30 2 108 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Bacteroides fragilis (strain YCH46)
C1DD43 1.02e-43 159 34 13 383 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Laribacter hongkongensis (strain HLHK9)
Q5HB57 1.19e-43 159 31 14 385 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ehrlichia ruminantium (strain Welgevonden)
Q5FHA6 1.43e-43 159 31 13 384 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Ehrlichia ruminantium (strain Gardel)
Q5GRK4 1.67e-43 159 30 10 390 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q73IP1 2.03e-43 159 30 9 388 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia pipientis wMel
C0R5E5 6.83e-43 157 30 9 388 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B2UKT9 7.91e-43 160 35 6 278 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B2UKT9 1.17e-12 72 31 4 159 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
B3CNN4 4.77e-41 152 29 9 391 3 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) Wolbachia pipientis subsp. Culex pipiens (strain wPip)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02970
Feature type CDS
Gene ispG
Product flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase
Location 563257 - 564381 (strand: -1)
Length 1125 (nucleotides) / 374 (amino acids)

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_511
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04551 GcpE protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0821 Lipid transport and metabolism (I) I 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase IspG/GcpE

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03526 (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase [EC:1.17.7.1 1.17.7.3] Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
C5 isoprenoid biosynthesis, non-mevalonate pathway

Protein Sequence

MHNESPIKRRKSTRIYVGNVPVGDGAPIAVQSMTNTRTTDVEATVRQIKSLERVGVDIVRVSVPTMDAAEAFKLIKQQVSVPLVADIHFDYRIALKVAEYGVDCLRINPGNIGSEERIRQVVDCARHYNIPIRIGVNGGSLEKDIQEKYGEPTPEALVESAMRHVDILDRLNFDQFKVSVKASDVFLAVGAYRLLAQKIDQPLHLGITEAGGARAGSVKSAIGLGMLLADGIGDTLRISLAADPVEEVKVGFDILKSLRIRSRGINFIACPTCSRQEFDVIGTVNALEQRLEDIITPMDVSIIGCVVNGPGEAEVSTLGVTGAKTRSGFYEDGVRQKERLDNTDMIDLLEAKIRAKAAMLDQNNRIDISLVEKE

Flanking regions ( +/- flanking 50bp)

AATAAACACAGCAATGATTAAGGACACAAGGATGTTCCGGAGAAAGACTTATGCATAATGAATCCCCGATAAAAAGACGCAAATCCACCCGAATTTACGTGGGAAATGTGCCGGTCGGTGATGGTGCACCAATCGCCGTACAATCAATGACAAACACCCGGACAACGGATGTTGAGGCGACCGTCAGACAAATTAAATCCCTGGAACGCGTCGGCGTGGATATTGTCCGCGTGTCAGTACCGACCATGGATGCGGCGGAAGCATTTAAACTGATTAAACAGCAGGTCTCTGTACCGCTGGTGGCGGATATTCACTTTGACTACCGCATTGCGCTGAAAGTGGCGGAATACGGCGTGGATTGTCTGCGTATCAACCCGGGCAATATCGGCAGCGAGGAGCGTATCCGTCAGGTGGTGGATTGCGCCCGTCATTATAATATCCCTATCCGTATCGGGGTTAACGGTGGTTCACTGGAAAAAGATATCCAGGAAAAATACGGCGAACCGACGCCGGAAGCACTGGTGGAATCTGCCATGCGTCATGTGGACATTCTCGATCGCCTGAATTTTGACCAGTTCAAAGTCAGTGTAAAAGCGTCTGATGTGTTCCTGGCGGTCGGTGCTTACCGTCTGCTGGCACAGAAAATTGATCAGCCGCTGCACCTGGGTATTACCGAAGCGGGCGGCGCACGTGCCGGTTCTGTGAAATCCGCTATCGGGTTAGGTATGCTGCTGGCGGACGGTATCGGTGATACGCTGCGTATCTCACTGGCAGCCGATCCGGTGGAAGAAGTGAAGGTCGGGTTTGATATCCTGAAATCCCTGCGTATCCGTTCGCGCGGCATTAACTTTATCGCCTGTCCGACCTGCTCCCGTCAGGAGTTCGACGTGATTGGCACTGTTAATGCCCTGGAACAACGGCTGGAAGATATCATCACTCCGATGGATGTGTCGATTATCGGCTGTGTGGTTAACGGCCCGGGCGAGGCGGAAGTCTCCACACTGGGGGTGACCGGCGCGAAAACCCGCAGCGGGTTCTACGAAGACGGTGTCCGTCAGAAAGAGCGCCTGGATAACACCGATATGATTGATCTGCTGGAAGCGAAAATCCGTGCCAAAGCGGCCATGCTGGATCAGAATAACCGGATTGATATCAGTCTGGTTGAGAAAGAATAATCGCGGACCGGCTCATTATTGATGAGCCGGTTTTGTCTGTTTTGGCAGAT