Homologs in group_3173

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00810 FBDBKF_00810 100.0 Morganella morganii S1 - hypothetical protein
EHELCC_00735 EHELCC_00735 100.0 Morganella morganii S2 - hypothetical protein
LHKJJB_04240 LHKJJB_04240 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_02805 HKOGLL_02805 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3173

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3173

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02725
Feature type CDS
Gene -
Product hypothetical protein
Location 520756 - 520863 (strand: 1)
Length 108 (nucleotides) / 35 (amino acids)
In genomic island -

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3173
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MAVKGNFQEGQAKRICLFTKSIQSHYRFGNAILSI

Flanking regions ( +/- flanking 50bp)

TATCCGATGAGTATTAACACACTATTCCCTTTAACTCAGTTAGGTATCGGATGGCTGTCAAAGGGAATTTTCAGGAAGGACAGGCAAAACGGATTTGCCTGTTTACCAAATCAATCCAGTCACATTACCGCTTTGGCAATGCCATCCTCTCGATATAGCGTAATATCGGCGGGAAGCGCGGAAAGTTTACGTTTTTTTATTGCCCGTG