Homologs in group_3172

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_00735 EHELCC_00735 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_02725 NLDBIP_02725 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_04240 LHKJJB_04240 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_02805 HKOGLL_02805 100.0 Morganella morganii S5 - hypothetical protein

Distribution of the homologs in the orthogroup group_3172

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3172

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_00810
Feature type CDS
Gene -
Product hypothetical protein
Location 149488 - 149595 (strand: 1)
Length 108 (nucleotides) / 35 (amino acids)

Contig

Accession contig_1
Length 309072 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3172
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Protein Sequence

MAVKGNFQEGQAKRICLFTKSIQSHYRFGNAILSI

Flanking regions ( +/- flanking 50bp)

TATCCGATGAGTATTAACACACTATTCCCTTTAACTCAGTTAGGTATCGGATGGCTGTCAAAGGGAATTTTCAGGAAGGACAGGCAAAACGGATTTGCCTGTTTACCAAATCAATCCAGTCACATTACCGCTTTGGCAATGCCATCCTCTCGATATAGCGTAATATCGGCGGGAAGCGCGGAAAGTTTACGTTTTTTTATTGCCCGTG