Homologs in group_3148

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00250 FBDBKF_00250 100.0 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
EHELCC_01295 EHELCC_01295 100.0 Morganella morganii S2 - HTH cro/C1-type domain-containing protein
LHKJJB_03680 LHKJJB_03680 100.0 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
HKOGLL_03365 HKOGLL_03365 100.0 Morganella morganii S5 - HTH cro/C1-type domain-containing protein

Distribution of the homologs in the orthogroup group_3148

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3148

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P03036 9.37e-25 90 67 0 64 1 CRO Regulatory protein cro Enterobacteria phage 434
P16117 5.12e-17 71 53 0 62 1 CI Repressor protein CI (Fragment) Enterobacteria phage 434
Q79S39 9.7e-11 57 48 0 64 4 s087 HTH-type transcriptional regulator for conjugative element SXT Vibrio cholerae
Q8GJK1 9.7e-11 57 48 0 64 4 None HTH-type transcriptional regulator for conjugative element pMERPH Shewanella putrefaciens
Q79RI9 9.7e-11 57 48 0 64 4 ORF-96 HTH-type transcriptional regulator for conjugative element R391 Providencia rettgeri
Q47587 9.98e-10 55 42 0 63 4 rdgA HTH-type transcriptional regulator RdgA Pectobacterium carotovorum subsp. carotovorum
Q37906 2.48e-06 45 37 0 61 4 CI Repressor protein CI Pseudomonas phage D3
Q06553 5.45e-06 45 36 0 65 2 prtR HTH-type transcriptional regulator PrtR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_02165
Feature type CDS
Gene -
Product HTH cro/C1-type domain-containing protein
Location 408285 - 408491 (strand: -1)
Length 207 (nucleotides) / 68 (amino acids)
In genomic island GI9

Contig

Accession ZDB_519
Length 680340 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3148
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MSTLSERVKTRRIALNLTQSELAEMVGLKQQSIQQIESGFIKRPRFIVEIATALKCDPSWLICGADAA

Flanking regions ( +/- flanking 50bp)

AAACAAACTAATTTGTTTTTAAATACAAGAAACTTTGTCAAGGAGGCACGATGAGTACACTATCGGAAAGAGTTAAAACTCGTCGCATAGCGCTTAATCTTACCCAGTCAGAATTAGCTGAGATGGTTGGATTAAAACAGCAATCAATTCAACAGATTGAATCAGGATTCATCAAAAGACCGCGATTTATTGTTGAAATTGCTACTGCACTGAAATGCGACCCAAGTTGGCTGATCTGCGGCGCAGATGCAGCATAAAAATAAAATCACCGCTCTTTACACAATTTAGCCCGTTCCGGATATGTGCT