Homologs in group_2137

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15810 FBDBKF_15810 100.0 Morganella morganii S1 yajQ YajQ family cyclic di-GMP-binding protein
EHELCC_19640 EHELCC_19640 100.0 Morganella morganii S2 yajQ YajQ family cyclic di-GMP-binding protein
NLDBIP_19635 NLDBIP_19635 100.0 Morganella morganii S4 yajQ YajQ family cyclic di-GMP-binding protein
HKOGLL_19515 HKOGLL_19515 100.0 Morganella morganii S5 yajQ YajQ family cyclic di-GMP-binding protein
F4V73_RS16500 F4V73_RS16500 90.8 Morganella psychrotolerans - YajQ family cyclic di-GMP-binding protein
PMI_RS00490 PMI_RS00490 79.8 Proteus mirabilis HI4320 - YajQ family cyclic di-GMP-binding protein

Distribution of the homologs in the orthogroup group_2137

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2137

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N0K1 1.1e-96 279 80 0 163 3 plu3881 UPF0234 protein plu3881 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EU40 1.63e-94 273 79 0 163 3 PMI0103 UPF0234 protein PMI0103 Proteus mirabilis (strain HI4320)
C6DB43 8.47e-89 259 75 0 163 3 PC1_1036 UPF0234 protein PC1_1036 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BCJ0 7.34e-88 256 74 0 163 3 NT01EI_1072 UPF0234 protein NT01EI_1072 Edwardsiella ictaluri (strain 93-146)
Q8ZRC9 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TMB5 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella schwarzengrund (strain CVM19633)
A9MWZ5 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWS7 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella newport (strain SL254)
B5FKU0 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella dublin (strain CT_02021853)
Q57SC9 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella choleraesuis (strain SC-B67)
B5EXH5 6.95e-87 254 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella agona (strain SL483)
Q6D838 7.59e-87 254 71 0 163 3 ECA1137 UPF0234 protein ECA1137 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MFH0 1.67e-86 253 74 0 163 3 ESA_02876 UPF0234 protein ESA_02876 Cronobacter sakazakii (strain ATCC BAA-894)
A8GAP8 4.48e-86 252 72 0 163 3 Spro_1084 UPF0234 protein Spro_1084 Serratia proteamaculans (strain 568)
B5Y0W4 9.65e-86 251 75 0 163 3 KPK_4305 UPF0234 protein KPK_4305 Klebsiella pneumoniae (strain 342)
Q8Z8W2 1.2e-85 251 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella typhi
B4T9D0 1.51e-85 251 76 0 163 3 yajQ UPF0234 protein YajQ Salmonella heidelberg (strain SL476)
A6T5G0 2.03e-85 250 74 0 163 3 KPN78578_03700 UPF0234 protein KPN78578_03700 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5PFQ2 4.83e-85 249 75 0 163 3 yajQ UPF0234 protein YajQ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8AK28 6.09e-85 249 74 0 163 3 CKO_02735 UPF0234 protein CKO_02735 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4W797 8.27e-85 249 73 0 163 3 Ent638_0893 UPF0234 protein Ent638_0893 Enterobacter sp. (strain 638)
B2K6U4 3.26e-84 247 70 0 163 3 YPTS_0987 UPF0234 protein YPTS_0987 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66DU7 3.26e-84 247 70 0 163 3 YPTB0946 UPF0234 protein YPTB0946 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JID2 3.26e-84 247 70 0 163 3 YPK_3247 UPF0234 protein YPK_3247 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q8ZC52 3.26e-84 247 70 0 163 3 YPO3170 UPF0234 protein YPO3170/y1016/YP_0761 Yersinia pestis
A7FLD6 3.26e-84 247 70 0 163 3 YpsIP31758_3104 UPF0234 protein YpsIP31758_3104 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9QZR6 3.26e-84 247 70 0 163 3 YpAngola_A3067 UPF0234 protein YpAngola_A3067 Yersinia pestis bv. Antiqua (strain Angola)
A4TPF5 3.26e-84 247 70 0 163 3 YPDSF_2805 UPF0234 protein YPDSF_2805 Yersinia pestis (strain Pestoides F)
Q1C4J6 3.26e-84 247 70 0 163 3 YPA_2664 UPF0234 protein YPA_2664 Yersinia pestis bv. Antiqua (strain Antiqua)
A1JNQ7 4.67e-84 247 71 0 163 3 YE3147 UPF0234 protein YE3147 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q9CKG2 2.39e-83 245 72 0 163 3 PM1656 UPF0234 protein PM1656 Pasteurella multocida (strain Pm70)
Q3Z4Y3 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Shigella sonnei (strain Ss046)
Q0T7G3 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Shigella flexneri serotype 5b (strain 8401)
Q325H5 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Shigella boydii serotype 4 (strain Sb227)
B2U4N0 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LMG1 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RFB4 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain UTI89 / UPEC)
B1LJH6 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain SMS-3-5 / SECEC)
B6HZM9 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain SE11)
B7N8X9 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8E7 2.42e-83 245 72 0 163 1 yajQ UPF0234 protein YajQ Escherichia coli (strain K12)
B1J023 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8E8 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKL6 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZX79 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O9:H4 (strain HS)
B1XFL4 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain K12 / DH10B)
C4ZTI3 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain K12 / MC4100 / BW2952)
B7M3R5 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O8 (strain IAI1)
B7NJ71 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z3T2 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8E9 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O157:H7
B7L660 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli (strain 55989 / EAEC)
B7MD84 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZII0 2.42e-83 245 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32JI4 3.79e-83 244 72 0 163 3 yajQ UPF0234 protein YajQ Shigella dysenteriae serotype 1 (strain Sd197)
B7UJP9 4.52e-83 244 72 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B2VHS6 1.31e-82 243 69 0 163 3 ETA_25210 UPF0234 protein ETA_25210 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P59561 1.56e-82 243 71 0 163 3 yajQ UPF0234 protein YajQ Shigella flexneri
B7MQE1 2.07e-82 243 71 0 163 3 yajQ UPF0234 protein YajQ Escherichia coli O81 (strain ED1a)
C4K7L1 3.43e-81 239 68 0 163 3 HDEF_1968 UPF0234 protein HDEF_1968 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A6VR60 7.84e-77 229 68 0 163 3 Asuc_2113 UPF0234 protein Asuc_2113 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A3N1N1 3.63e-76 227 66 0 163 3 APL_1231 UPF0234 protein APL_1231 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A5UD62 3.97e-76 227 65 0 163 3 CGSHiEE_06890 UPF0234 protein CGSHiEE_06890 Haemophilus influenzae (strain PittEE)
Q4QLP7 3.97e-76 227 65 0 163 3 NTHI1194 UPF0234 protein NTHI1194 Haemophilus influenzae (strain 86-028NP)
P44096 3.97e-76 227 65 0 163 1 HI_1034 UPF0234 protein HI_1034 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UIG4 1.24e-75 226 65 0 163 3 CGSHiGG_08790 UPF0234 protein CGSHiGG_08790 Haemophilus influenzae (strain PittGG)
B3H202 4.52e-75 224 65 0 163 3 APP7_1280 UPF0234 protein APP7_1280 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BQG3 4.52e-75 224 65 0 163 3 APJL_1242 UPF0234 protein APJL_1242 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q7VNW8 2.05e-74 223 63 0 163 3 HD_0358 UPF0234 protein HD_0358 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q65RP4 5.93e-74 221 65 0 163 3 MS1759 UPF0234 protein MS1759 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0UTI0 1.93e-72 218 63 0 163 3 HSM_1099 UPF0234 protein HSM_1099 Histophilus somni (strain 2336)
Q0I2U5 2.15e-72 218 63 0 163 3 HS_0688 UPF0234 protein HS_0688 Histophilus somni (strain 129Pt)
C5BRG2 2.04e-68 207 63 2 163 3 TERTU_3542 UPF0234 protein TERTU_3542 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B8F8L6 5.45e-68 206 60 0 163 3 HAPS_2236 UPF0234 protein HAPS_2236 Glaesserella parasuis serovar 5 (strain SH0165)
Q0HYJ5 9.49e-67 203 60 1 163 3 Shewmr7_0811 UPF0234 protein Shewmr7_0811 Shewanella sp. (strain MR-7)
Q0HFE0 9.49e-67 203 60 1 163 3 Shewmr4_3156 UPF0234 protein Shewmr4_3156 Shewanella sp. (strain MR-4)
Q21ND2 9.67e-66 201 62 3 165 3 Sde_0533 UPF0234 protein Sde_0533 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8EAS7 1.73e-65 200 58 1 163 3 SO_3815 UPF0234 protein SO_3815 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3QH11 1.99e-65 200 58 1 163 3 Shew_2893 UPF0234 protein Shew_2893 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A3D0H5 3.32e-64 197 58 1 163 3 Sbal_0710 UPF0234 protein Sbal_0710 Shewanella baltica (strain OS155 / ATCC BAA-1091)
A9L2C1 3.32e-64 197 58 1 163 3 Sbal195_3724 UPF0234 protein Sbal195_3724 Shewanella baltica (strain OS195)
A6WSD7 3.32e-64 197 58 1 163 3 Shew185_3601 UPF0234 protein Shew185_3601 Shewanella baltica (strain OS185)
B8E801 3.32e-64 197 58 1 163 3 Sbal223_3532 UPF0234 protein Sbal223_3532 Shewanella baltica (strain OS223)
A8FYX4 4.71e-64 196 58 1 163 3 Ssed_3443 UPF0234 protein Ssed_3443 Shewanella sediminis (strain HAW-EB3)
B8CKA9 1.97e-63 194 59 1 163 3 swp_1151 UPF0234 protein swp_1151 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q12R66 1.04e-62 193 59 1 163 3 Sden_0770 UPF0234 protein Sden_0770 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A8H793 1.12e-62 193 59 1 163 3 Spea_3114 UPF0234 protein Spea_3114 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A5F818 1.17e-62 192 58 2 163 3 VC0395_A1115 UPF0234 protein VC0395_A1115/VC395_1627 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q9KRX5 1.17e-62 192 58 2 163 3 VC_1508 UPF0234 protein VC_1508 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LMJ0 1.17e-62 192 58 2 163 3 VCM66_1450 UPF0234 protein VCM66_1450 Vibrio cholerae serotype O1 (strain M66-2)
A0KHB9 1.56e-62 192 58 2 163 3 AHA_1129 UPF0234 protein AHA_1129 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5E5G1 2.05e-62 192 57 2 163 3 VF_1240 UPF0234 protein VF_1240 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0TR14 4.87e-62 191 58 1 163 3 Shal_3198 UPF0234 protein Shal_3198 Shewanella halifaxensis (strain HAW-EB4)
A4SQM8 5.38e-62 191 58 2 163 3 ASA_3207 UPF0234 protein ASA_3207 Aeromonas salmonicida (strain A449)
B1KD73 6.4e-62 191 58 1 163 3 Swoo_3646 UPF0234 protein Swoo_3646 Shewanella woodyi (strain ATCC 51908 / MS32)
A1S8Q3 8.42e-62 191 55 1 163 3 Sama_2557 UPF0234 protein Sama_2557 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B5FDX9 1.18e-61 190 57 2 163 3 VFMJ11_1323 UPF0234 protein VFMJ11_1323 Aliivibrio fischeri (strain MJ11)
Q087H5 1.41e-61 190 58 1 163 3 Sfri_0732 UPF0234 protein Sfri_0732 Shewanella frigidimarina (strain NCIMB 400)
B6EN03 1.61e-61 190 57 2 163 3 VSAL_I1728 UPF0234 protein VSAL_I1728 Aliivibrio salmonicida (strain LFI1238)
Q3IHS5 7.76e-61 188 60 2 163 3 PSHAa2277 UPF0234 protein PSHAa2277 Pseudoalteromonas translucida (strain TAC 125)
Q15MS8 1.1e-59 185 55 2 163 3 Patl_4311 UPF0234 protein Patl_4311 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
P59562 3.13e-59 184 56 2 163 3 VP1617 UPF0234 protein VP1617 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D9E8 4.2e-59 184 55 2 163 3 VV1_2655 UPF0234 protein VV1_2655 Vibrio vulnificus (strain CMCP6)
Q7MKZ1 4.3e-59 184 55 2 163 3 VV1636 UPF0234 protein VV1636 Vibrio vulnificus (strain YJ016)
Q6LQJ9 5.11e-59 183 57 3 164 3 PBPRA2024 UPF0234 protein PBPRA2024 Photobacterium profundum (strain SS9)
B4RS97 2.88e-58 181 55 2 163 3 MADE_1020535 UPF0234 protein MADE_1020535 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B7VNJ2 8.23e-58 180 55 2 163 3 VS_1405 UPF0234 protein VS_1405 Vibrio atlanticus (strain LGP32)
Q5ZWB8 3.88e-57 179 54 1 163 3 lpg1167 UPF0234 protein lpg1167 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A7N0J7 9.33e-57 177 53 2 163 3 VIBHAR_02358 UPF0234 protein VIBHAR_02358 Vibrio campbellii (strain ATCC BAA-1116)
A5IB64 2.26e-56 177 53 1 163 3 LPC_0632 UPF0234 protein LPC_0632 Legionella pneumophila (strain Corby)
Q5WXC3 2.26e-56 177 53 1 163 3 lpl1175 UPF0234 protein lpl1175 Legionella pneumophila (strain Lens)
Q5X601 2.26e-56 177 53 1 163 3 lpp1169 UPF0234 protein lpp1169 Legionella pneumophila (strain Paris)
Q0VTG6 9.77e-56 175 53 1 163 3 ABO_0048 UPF0234 protein ABO_0048 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C4LBI8 1.05e-54 172 57 2 163 3 Tola_0795 UPF0234 protein Tola_0795 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q487C3 1.75e-54 172 52 2 163 3 CPS_1098 UPF0234 protein CPS_1098 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A9NA23 5.58e-54 171 54 3 164 3 COXBURSA331_A0203 UPF0234 protein COXBURSA331_A0203 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KET4 5.58e-54 171 54 3 164 3 CBUD_1993 UPF0234 protein CBUD_1993 Coxiella burnetii (strain Dugway 5J108-111)
B6J2R9 5.58e-54 171 54 3 164 3 CbuG_1898 UPF0234 protein CbuG_1898 Coxiella burnetii (strain CbuG_Q212)
Q83F37 5.58e-54 171 54 3 164 3 CBU_0114 UPF0234 protein CBU_0114 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B6J5L9 7.58e-54 170 54 3 164 3 CbuK_1936 UPF0234 protein CbuK_1936 Coxiella burnetii (strain CbuK_Q154)
A1SWY7 9.9e-52 165 47 2 163 3 Ping_2261 UPF0234 protein Ping_2261 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8GQ87 1.4e-51 164 50 2 163 3 Tgr7_1196 UPF0234 protein Tgr7_1196 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A6VWX6 5.31e-51 163 53 3 164 3 Mmwyl1_2033 UPF0234 protein Mmwyl1_2033 Marinomonas sp. (strain MWYL1)
C3JYU1 7.62e-51 163 50 2 163 3 PFLU_4927 UPF0234 protein PFLU_4927 Pseudomonas fluorescens (strain SBW25)
Q3K7U6 1.27e-50 162 51 2 163 3 Pfl01_4421 UPF0234 protein Pfl01_4421 Pseudomonas fluorescens (strain Pf0-1)
B7GWK1 1.9e-50 162 50 1 163 3 ABBFA_000537 UPF0234 protein ABBFA_000537 Acinetobacter baumannii (strain AB307-0294)
B0V634 1.9e-50 162 50 1 163 3 ABAYE0515 UPF0234 protein ABAYE0515 Acinetobacter baumannii (strain AYE)
B0VQZ2 1.9e-50 162 50 1 163 3 ABSDF0503 UPF0234 protein ABSDF0503 Acinetobacter baumannii (strain SDF)
B7I989 1.9e-50 162 50 1 163 3 AB57_3429 UPF0234 protein AB57_3429 Acinetobacter baumannii (strain AB0057)
Q4K7C7 2.27e-50 162 51 2 163 3 PFL_4775 UPF0234 protein PFL_4775 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4VP90 7.57e-50 160 51 2 163 3 PST_3153 UPF0234 protein PST_3153 Stutzerimonas stutzeri (strain A1501)
B3PLN2 1.04e-49 160 49 2 163 3 CJA_2652 UPF0234 protein CJA_2652 Cellvibrio japonicus (strain Ueda107)
C1DQB5 1.68e-49 159 51 3 163 3 Avin_13410 UPF0234 protein Avin_13410 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A6VB67 2.14e-49 159 50 2 163 3 PSPA7_4966 UPF0234 protein PSPA7_4966 Pseudomonas aeruginosa (strain PA7)
Q02H45 3.24e-49 159 50 2 163 3 PA14_57130 UPF0234 protein PA14_57130 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q87X00 4.64e-49 158 51 3 163 3 PSPTO_4393 UPF0234 protein PSPTO_4393 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B1J3J6 6.92e-49 158 50 2 163 3 PputW619_0959 UPF0234 protein PputW619_0959 Pseudomonas putida (strain W619)
B7UZH3 9.64e-49 157 49 2 163 3 PLES_47741 UPF0234 protein PLES_47741 Pseudomonas aeruginosa (strain LESB58)
Q9HW11 9.64e-49 157 49 2 163 3 PA4395 UPF0234 protein PA4395 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A4XQU1 1.4e-48 157 49 2 163 3 Pmen_0939 UPF0234 protein Pmen_0939 Pseudomonas mendocina (strain ymp)
Q48EH2 1.59e-48 157 51 3 163 3 PSPPH_4093 UPF0234 protein PSPPH_4093 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A5W8N5 3.19e-48 156 50 2 163 3 Pput_4372 UPF0234 protein Pput_4372 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
P59560 3.19e-48 156 50 2 163 3 PP_1352 UPF0234 protein PP_1352 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KFR1 9.71e-48 155 50 2 163 3 PputGB1_4497 UPF0234 protein PputGB1_4497 Pseudomonas putida (strain GB-1)
Q6F7Y7 1.3e-47 154 49 1 163 3 ACIAD3137 UPF0234 protein ACIAD3137 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4ZP05 1.44e-47 154 50 3 163 3 Psyr_4087 UPF0234 protein Psyr_4087 Pseudomonas syringae pv. syringae (strain B728a)
Q1I5D3 1.87e-47 154 50 2 163 3 PSEEN4469 UPF0234 protein PSEEN4469 Pseudomonas entomophila (strain L48)
Q7VUZ9 2.11e-45 149 46 2 163 3 BP2916 UPF0234 protein BP2916 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WMU0 2.11e-45 149 46 2 163 3 BB1300 UPF0234 protein BB1300 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WBC1 2.11e-45 149 46 2 163 3 BPP1084 UPF0234 protein BPP1084 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A9BM65 3.91e-44 145 47 1 163 3 Daci_4781 UPF0234 protein Daci_4781 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q31ED1 7.52e-44 145 47 3 164 3 Tcr_1902 UPF0234 protein Tcr_1902 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B4SJP5 2.39e-43 144 44 2 163 3 Smal_3487 UPF0234 protein Smal_3487 Stenotrophomonas maltophilia (strain R551-3)
A9I0D6 2.64e-43 144 45 2 163 3 Bpet3698 UPF0234 protein Bpet3698 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q2KWN1 3.11e-43 143 46 2 163 3 BAV0791 UPF0234 protein BAV0791 Bordetella avium (strain 197N)
Q3SHT4 3.58e-43 143 46 1 163 3 Tbd_1846 UPF0234 protein Tbd_1846 Thiobacillus denitrificans (strain ATCC 25259)
Q1QUI7 3.73e-43 143 46 3 164 3 Csal_2524 UPF0234 protein Csal_2524 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8PGE6 2.28e-42 141 46 3 164 3 XAC3671 UPF0234 protein XAC3671 Xanthomonas axonopodis pv. citri (strain 306)
Q1H0L3 2.72e-42 141 48 1 164 3 Mfla_1706 UPF0234 protein Mfla_1706 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5H505 2.74e-42 141 46 3 164 3 XOO0711 UPF0234 protein XOO0711 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P7S5 2.74e-42 141 46 3 164 3 XOO0647 UPF0234 protein XOO0647 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
C6BXD5 3.74e-42 140 46 2 163 3 Desal_2385 UPF0234 protein Desal_2385 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B2FHW7 3.77e-42 140 44 2 163 3 Smlt4090 UPF0234 protein Smlt4090 Stenotrophomonas maltophilia (strain K279a)
B0RWE6 5.57e-42 140 45 3 164 3 xcc-b100_3818 UPF0234 protein xcc-b100_3818 Xanthomonas campestris pv. campestris (strain B100)
Q4UQD0 5.57e-42 140 45 3 164 1 XC_3703 UPF0234 protein XC_3703 Xanthomonas campestris pv. campestris (strain 8004)
Q8P4S5 5.57e-42 140 45 3 164 3 XCC3632 UPF0234 protein XCC3632 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q3BNZ1 8.07e-42 140 45 3 164 3 XCV3791 UPF0234 protein XCV3791 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7NWE3 1.07e-41 140 47 4 169 3 CV_2047 UPF0234 protein CV_2047 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B9MBJ9 2.7e-41 139 47 4 165 3 Dtpsy_2240 UPF0234 protein Dtpsy_2240 Acidovorax ebreus (strain TPSY)
A0L886 2.7e-41 139 43 1 163 3 Mmc1_1670 UPF0234 protein Mmc1_1670 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1TNA0 2.79e-41 139 46 1 163 3 Aave_1854 UPF0234 protein Aave_1854 Paracidovorax citrulli (strain AAC00-1)
Q3J8Y4 3.16e-41 138 49 3 164 3 Noc_2254 UPF0234 protein Noc_2254 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2SDF4 3.47e-41 138 46 3 164 3 HCH_04620 UPF0234 protein HCH_04620 Hahella chejuensis (strain KCTC 2396)
C5CUU9 4.76e-41 138 45 1 163 3 Vapar_3769 UPF0234 protein Vapar_3769 Variovorax paradoxus (strain S110)
Q8XWC5 6.97e-41 137 43 1 163 3 RSc2549 UPF0234 protein RSc2549 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A1W9G6 7.86e-41 137 47 4 165 3 Ajs_2750 UPF0234 protein Ajs_2750 Acidovorax sp. (strain JS42)
A1WNH8 1.34e-40 137 44 1 163 3 Veis_3464 UPF0234 protein Veis_3464 Verminephrobacter eiseniae (strain EF01-2)
A2SKA3 1.59e-40 137 46 3 165 3 Mpe_A3039 UPF0234 protein Mpe_A3039 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C1D7H3 1.63e-40 136 46 1 163 3 LHK_01423 UPF0234 protein LHK_01423 Laribacter hongkongensis (strain HLHK9)
B7J7F3 2.44e-40 136 39 1 163 3 AFE_0977 UPF0234 protein AFE_0977 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B5EQ88 2.44e-40 136 39 1 163 3 Lferr_1091 UPF0234 protein Lferr_1091 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B2UBA0 2.58e-40 136 44 1 163 3 Rpic_2826 UPF0234 protein Rpic_2826 Ralstonia pickettii (strain 12J)
Q2T0L3 2.69e-40 136 44 3 164 3 BTH_I0730 UPF0234 protein BTH_I0730 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B1YVE8 4.39e-40 135 43 3 164 3 BamMC406_2474 UPF0234 protein BamMC406_2474 Burkholderia ambifaria (strain MC40-6)
Q0BCG4 7.65e-40 135 43 3 164 3 Bamb_2603 UPF0234 protein Bamb_2603 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q022D2 8.3e-40 135 45 1 164 3 Acid_3194 UPF0234 protein Acid_3194 Solibacter usitatus (strain Ellin6076)
Q21UZ5 8.81e-40 135 44 1 163 3 Rfer_2692 UPF0234 protein Rfer_2692 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A4G3G5 1e-39 134 45 3 164 3 HEAR0865 UPF0234 protein HEAR0865 Herminiimonas arsenicoxydans
Q2YA74 1.18e-39 134 45 1 163 3 Nmul_A1044 UPF0234 protein Nmul_A1044 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q39DI5 1.47e-39 134 43 3 164 3 Bcep18194_A5887 UPF0234 protein Bcep18194_A5887 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0K786 2.18e-39 134 43 1 163 3 H16_A3060 UPF0234 protein H16_A3060 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q747R1 3.12e-39 133 43 1 163 3 GSU3204 UPF0234 protein GSU3204 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q12D58 3.4e-39 133 45 3 164 3 Bpro_1596 UPF0234 protein Bpro_1596 Polaromonas sp. (strain JS666 / ATCC BAA-500)
B3R6D3 4.37e-39 133 42 1 163 3 RALTA_A2535 UPF0234 protein RALTA_A2535 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q6MQW5 4.66e-39 133 41 1 162 3 Bd0338 UPF0234 protein Bd0338 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A4JH87 4.81e-39 133 43 3 164 3 Bcep1808_2648 UPF0234 protein Bcep1808_2648 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0AID7 5.61e-39 132 46 1 163 3 Neut_0623 UPF0234 protein Neut_0623 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B6IWZ8 7.2e-39 132 44 1 163 3 RC1_3464 UPF0234 protein RC1_3464 Rhodospirillum centenum (strain ATCC 51521 / SW)
B8G089 7.39e-39 132 44 1 161 3 Dhaf_3127 UPF0234 protein Dhaf_3127 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q24W34 7.39e-39 132 44 1 161 3 DSY1969 UPF0234 protein DSY1969 Desulfitobacterium hafniense (strain Y51)
A6SW83 7.52e-39 132 44 3 164 3 mma_0840 UPF0234 protein mma_0840 Janthinobacterium sp. (strain Marseille)
Q13UQ9 9.87e-39 132 41 1 163 3 Bxeno_A3642 UPF0234 protein Bxeno_A3642 Paraburkholderia xenovorans (strain LB400)
Q1LJA4 1.3e-38 132 42 1 163 3 Rmet_2899 UPF0234 protein Rmet_2899 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2KBL5 1.48e-38 132 42 2 161 3 Emin_0136 UPF0234 protein Emin_0136 Elusimicrobium minutum (strain Pei191)
A3NS79 1.53e-38 131 42 3 164 3 BURPS1106A_0919 UPF0234 protein BURPS1106A_0919 Burkholderia pseudomallei (strain 1106a)
A3N6J5 1.53e-38 131 42 3 164 3 BURPS668_0915 UPF0234 protein BURPS668_0915 Burkholderia pseudomallei (strain 668)
Q63WM4 1.53e-38 131 42 3 164 3 BPSL0867 UPF0234 protein BPSL0867 Burkholderia pseudomallei (strain K96243)
A2S947 1.53e-38 131 42 3 164 3 BMA10229_A2508 UPF0234 protein BMA10229_A2508 Burkholderia mallei (strain NCTC 10229)
Q62M78 1.53e-38 131 42 3 164 3 BMA0373 UPF0234 protein BMA0373 Burkholderia mallei (strain ATCC 23344)
A3MHG5 1.53e-38 131 42 3 164 3 BMA10247_0122 UPF0234 protein BMA10247_0122 Burkholderia mallei (strain NCTC 10247)
A1V1B6 1.53e-38 131 42 3 164 3 BMASAVP1_A0673 UPF0234 protein BMASAVP1_A0673 Burkholderia mallei (strain SAVP1)
Q3JVC0 1.53e-38 131 42 3 164 3 BURPS1710b_1071 UPF0234 protein BURPS1710b_1071 Burkholderia pseudomallei (strain 1710b)
B4E9G8 1.86e-38 131 42 3 164 3 BceJ2315_27070 UPF0234 protein BceJ2315_27070 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A7HV58 1.88e-38 131 39 1 163 3 Plav_2177 UPF0234 protein Plav_2177 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A1VL69 2.24e-38 131 44 2 164 3 Pnap_1080 UPF0234 protein Pnap_1080 Polaromonas naphthalenivorans (strain CJ2)
B2SY65 2.38e-38 131 41 1 163 3 Bphyt_3208 UPF0234 protein Bphyt_3208 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q46XL2 3.16e-38 130 42 1 163 3 Reut_A2760 UPF0234 protein Reut_A2760 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q82SQ9 3.68e-38 130 44 1 163 3 NE2248 UPF0234 protein NE2248 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B3QV75 4.72e-38 130 41 0 160 3 Ctha_0558 UPF0234 protein Ctha_0558 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q47BM3 5.16e-38 130 40 1 164 3 Daro_3028 UPF0234 protein Daro_3028 Dechloromonas aromatica (strain RCB)
Q39QQ5 6.07e-38 130 42 1 163 3 Gmet_3206 UPF0234 protein Gmet_3206 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A7ZBD9 7.61e-38 130 44 0 160 3 Ccon26_01810 UPF0234 protein Ccon26_01810 Campylobacter concisus (strain 13826)
Q72AL1 1.32e-37 129 41 0 163 3 DVU_1981 UPF0234 protein DVU_1981 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1VCP5 1.32e-37 129 41 0 163 3 Dvul_1191 UPF0234 protein Dvul_1191 Nitratidesulfovibrio vulgaris (strain DP4)
A0RRF8 1.41e-37 129 45 0 160 3 CFF8240_1664 UPF0234 protein CFF8240_1664 Campylobacter fetus subsp. fetus (strain 82-40)
A4J5U5 2.18e-37 129 44 1 160 3 Dred_1927 UPF0234 protein Dred_1927 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B1XTD4 2.27e-37 129 41 1 163 3 Pnec_0318 UPF0234 protein Pnec_0318 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q5P0Z4 4.03e-37 128 44 1 163 3 AZOSEA28950 UPF0234 protein AZOSEA28950 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1K7J5 4.64e-37 128 44 1 163 3 azo2183 UPF0234 protein azo2183 Azoarcus sp. (strain BH72)
A9AGJ4 1.11e-36 127 42 1 163 3 Bmul_0741 UPF0234 protein Bmul_0741/BMULJ_02519 Burkholderia multivorans (strain ATCC 17616 / 249)
A6Q6S7 1.85e-36 126 44 3 161 3 SUN_0226 UPF0234 protein SUN_0226 Sulfurovum sp. (strain NBC37-1)
A7GW77 2.84e-36 126 43 0 160 3 Ccur92_01650 UPF0234 protein Ccur92_01650 Campylobacter curvus (strain 525.92)
C4L0Z7 5.8e-36 125 45 1 160 3 EAT1b_2037 UPF0234 protein EAT1b_2037 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q5YPB9 6.19e-36 125 45 4 163 3 NFA_51200 UPF0234 protein NFA_51200 Nocardia farcinica (strain IFM 10152)
B0THU1 6.44e-36 125 42 1 161 3 Helmi_22490 UPF0234 protein Helmi_22490 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B2JDU3 6.45e-36 125 42 1 163 3 Bphy_0527 UPF0234 protein Bphy_0527 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1JXG5 6.96e-36 125 41 1 163 3 Bcenmc03_2579 UPF0234 protein Bcenmc03_2579 Burkholderia orbicola (strain MC0-3)
A0K9X8 6.96e-36 125 41 1 163 3 Bcen2424_2555 UPF0234 protein Bcen2424_2555 Burkholderia cenocepacia (strain HI2424)
Q1BU58 6.96e-36 125 41 1 163 3 Bcen_1944 UPF0234 protein Bcen_1944 Burkholderia orbicola (strain AU 1054)
A8MI73 7.61e-36 125 43 4 162 3 Clos_1967 UPF0234 protein Clos_1967 Alkaliphilus oremlandii (strain OhILAs)
A5GBW0 8.46e-36 124 42 1 162 3 Gura_0717 UPF0234 protein Gura_0717 Geotalea uraniireducens (strain Rf4)
A4SVJ7 8.83e-36 124 39 1 163 3 Pnuc_0290 UPF0234 protein Pnuc_0290 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q65LG2 1.19e-35 124 43 1 160 3 BLi01194 UPF0234 protein BLi01194/BL01306 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q9KAA3 1.73e-35 124 42 1 160 3 BH2387 UPF0234 protein BH2387 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B9M1Y7 2.13e-35 124 41 1 162 3 Geob_0921 UPF0234 protein Geob_0921 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B3EA29 2.62e-35 123 41 1 163 3 Glov_3198 UPF0234 protein Glov_3198 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B8DJB8 2.83e-35 123 41 2 163 3 DvMF_3058 UPF0234 protein DvMF_3058 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A5CUU9 3.21e-35 123 43 3 161 3 CMM_2802 UPF0234 protein CMM_2802 Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A0QLB6 3.3e-35 123 44 3 161 3 MAV_4575 UPF0234 protein MAV_4575 Mycobacterium avium (strain 104)
A7H6G9 3.65e-35 123 41 1 163 3 Anae109_0095 UPF0234 protein Anae109_0095 Anaeromyxobacter sp. (strain Fw109-5)
Q2W141 4.18e-35 123 39 1 163 3 amb3630 UPF0234 protein amb3630 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q73SL0 4.77e-35 122 44 3 161 3 MAP_4063c UPF0234 protein MAP_4063c Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
C3LBW1 1.08e-34 122 46 2 160 3 BAMEG_3419 UPF0234 protein BAMEG_3419 Bacillus anthracis (strain CDC 684 / NRRL 3495)
B7HZT6 1.08e-34 122 46 2 160 3 BCAH187_A1318 UPF0234 protein BCAH187_A1318 Bacillus cereus (strain AH187)
Q73BZ5 1.08e-34 122 46 2 160 3 BCE_1273 UPF0234 protein BCE_1273 Bacillus cereus (strain ATCC 10987 / NRS 248)
C3P3L1 1.08e-34 122 46 2 160 3 BAA_1246 UPF0234 protein BAA_1246 Bacillus anthracis (strain A0248)
B7JDW4 1.08e-34 122 46 2 160 3 BCAH820_1240 UPF0234 protein BCAH820_1240 Bacillus cereus (strain AH820)
B9ITG8 1.08e-34 122 46 2 160 3 BCQ_1220 UPF0234 protein BCQ_1220 Bacillus cereus (strain Q1)
C1EL70 1.08e-34 122 46 2 160 3 BCA_1202 UPF0234 protein BCA_1202 Bacillus cereus (strain 03BB102)
Q81TU4 1.08e-34 122 46 2 160 3 BA_1166 UPF0234 protein BA_1166/GBAA_1166/BAS1081 Bacillus anthracis
Q6HM20 1.08e-34 122 46 2 160 3 BT9727_1064 UPF0234 protein BT9727_1064 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63EK2 1.08e-34 122 46 2 160 3 BCE33L1059 UPF0234 protein BCE33L1059 Bacillus cereus (strain ZK / E33L)
C0QZ35 1.12e-34 122 39 0 161 3 BHWA1_00627 UPF0234 protein BHWA1_00627 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B7ILA4 1.7e-34 121 46 2 160 3 BCG9842_B4128 UPF0234 protein BCG9842_B4128 Bacillus cereus (strain G9842)
A1KG43 2.09e-34 121 44 3 161 3 BCG_0611c UPF0234 protein BCG_0611c Mycobacterium bovis (strain BCG / Pasteur 1173P2)
C1AKP6 2.09e-34 121 44 3 161 3 JTY_0581 UPF0234 protein JTY_0581 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
P67381 2.09e-34 121 44 3 161 3 BQ2027_MB0581C UPF0234 protein Mb0581c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A5TZU6 2.09e-34 121 44 3 161 3 MRA_0573 UPF0234 protein MRA_0573 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P9WFK9 2.09e-34 121 44 3 161 1 Rv0566c UPF0234 protein Rv0566c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFK8 2.09e-34 121 44 3 161 3 MT0592 UPF0234 protein MT0592 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1ATL8 2.15e-34 121 39 1 163 3 Ppro_3093 UPF0234 protein Ppro_3093 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A7GM53 2.83e-34 120 45 2 160 3 Bcer98_0876 UPF0234 protein Bcer98_0876 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q3A8J6 2.98e-34 120 40 1 162 3 Pcar_0033 UPF0234 protein Pcar_0033 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B7HGR9 3.23e-34 120 46 2 160 3 BCB4264_A1213 UPF0234 protein BCB4264_A1213 Bacillus cereus (strain B4264)
Q81GN2 3.23e-34 120 46 2 160 3 BC_1159 UPF0234 protein BC_1159 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q3ACU3 5.45e-34 120 41 0 160 3 CHY_1197 UPF0234 protein CHY_1197 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B9KE62 5.93e-34 120 43 1 160 3 Cla_1551 UPF0234 protein Cla_1551 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
A9VJ21 6.33e-34 120 46 2 160 3 BcerKBAB4_1061 UPF0234 protein BcerKBAB4_1061 Bacillus mycoides (strain KBAB4)
C0ZV24 8.21e-34 119 42 4 163 3 RER_17110 UPF0234 protein RER_17110 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q836E9 1.04e-33 119 42 1 161 3 EF_1165 UPF0234 protein EF_1165 Enterococcus faecalis (strain ATCC 700802 / V583)
B2HRR5 1.47e-33 119 43 3 161 3 MMAR_0920 UPF0234 protein MMAR_0920 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PLW6 1.47e-33 119 43 3 161 3 MUL_0671 UPF0234 protein MUL_0671 Mycobacterium ulcerans (strain Agy99)
A0QRM0 1.81e-33 119 42 3 161 1 MSMEG_1165 UPF0234 protein MSMEG_1165/MSMEI_1134 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A1T3T5 2.33e-33 118 42 3 161 3 Mvan_0997 UPF0234 protein Mvan_0997 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q0SF90 2.33e-33 118 42 4 163 3 RHA1_ro01989 UPF0234 protein RHA1_ro01989 Rhodococcus jostii (strain RHA1)
Q1DC88 2.77e-33 118 40 3 167 3 MXAN_1478 UPF0234 protein MXAN_1478 Myxococcus xanthus (strain DK1622)
A4FPS1 2.92e-33 118 40 3 162 3 SACE_6882 UPF0234 protein SACE_6882 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q5L203 3.05e-33 118 42 2 160 3 GK0742 UPF0234 protein GK0742 Geobacillus kaustophilus (strain HTA426)
Q2JFK0 3.73e-33 118 41 3 162 3 Francci3_0558 UPF0234 protein Francci3_0558 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
O06746 5.03e-33 117 41 1 160 3 yitK UPF0234 protein yitk Bacillus subtilis (strain 168)
C0ZCJ6 5.08e-33 117 43 2 160 3 BBR47_25280 UPF0234 protein BBR47_25280 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
C1AYY2 6.11e-33 117 42 4 163 3 ROP_16630 UPF0234 protein ROP_16630 Rhodococcus opacus (strain B4)
A4IL06 8.19e-33 117 43 2 160 3 GTNG_0630 UPF0234 protein GTNG_0630 Geobacillus thermodenitrificans (strain NG80-2)
A8LC81 1.08e-32 117 42 3 162 3 Franean1_6074 UPF0234 protein Franean1_6074 Parafrankia sp. (strain EAN1pec)
Q2IM40 1.31e-32 116 41 1 163 3 Adeh_0094 UPF0234 protein Adeh_0094 Anaeromyxobacter dehalogenans (strain 2CP-C)
A1VY95 1.46e-32 116 42 2 164 3 CJJ81176_0398 UPF0234 protein CJJ81176_0398 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q3ZYJ9 1.62e-32 116 34 0 162 3 cbdbA1256 UPF0234 protein cbdbA1256 Dehalococcoides mccartyi (strain CBDB1)
A5FQ25 1.62e-32 116 34 0 162 3 DehaBAV1_1126 UPF0234 protein DehaBAV1_1126 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B0SPT5 1.7e-32 116 38 2 162 3 LEPBI_I1392 UPF0234 protein LEPBI_I1392 Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0SGD4 1.7e-32 116 38 2 162 3 LBF_1338 UPF0234 protein LBF_1338 Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q0RRU6 1.74e-32 116 41 3 162 3 FRAAL1054 UPF0234 protein FRAAL1054 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
B5ED61 2.12e-32 116 40 1 162 3 Gbem_0619 UPF0234 protein Gbem_0619 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C6E091 2.15e-32 116 40 1 162 3 GM21_0633 UPF0234 protein GM21_0633 Geobacter sp. (strain M21)
A7H502 2.29e-32 116 42 2 164 3 JJD26997_1583 UPF0234 protein JJD26997_1583 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q9PIC8 2.45e-32 116 41 1 160 3 Cj0374 UPF0234 protein Cj0374 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A4T197 2.59e-32 115 43 3 161 3 Mflv_5248 UPF0234 protein Mflv_5248 Mycolicibacterium gilvum (strain PYR-GCK)
B1H0H0 3.22e-32 115 37 2 161 3 TGRD_519 UPF0234 protein TGRD_519 Endomicrobium trichonymphae
Q47LG7 3.25e-32 115 41 2 161 3 Tfu_2672 UPF0234 protein Tfu_2672 Thermobifida fusca (strain YX)
C5D742 3.35e-32 115 40 3 167 3 GWCH70_0711 UPF0234 protein GWCH70_0711 Geobacillus sp. (strain WCH70)
A7Z391 4.35e-32 115 43 2 160 3 RBAM_011030 UPF0234 protein RBAM_011030 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A8FKG2 5.12e-32 115 42 2 164 3 C8J_0350 UPF0234 protein C8J_0350 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B1MHA5 5.77e-32 115 40 3 161 3 MAB_3912 UPF0234 protein MAB_3912 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A8FBU5 6.36e-32 115 44 2 160 3 BPUM_1028 UPF0234 protein BPUM_1028 Bacillus pumilus (strain SAFR-032)
Q5HW93 7.4e-32 114 42 2 164 3 CJE0423 UPF0234 protein CJE0423 Campylobacter jejuni (strain RM1221)
Q1BDY7 8.16e-32 114 40 3 161 3 Mmcs_0777 UPF0234 protein Mmcs_0777 Mycobacterium sp. (strain MCS)
Q9F2U7 2.73e-31 113 41 3 161 1 SCO4614 UPF0234 protein SCO4614 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q82DS2 4.17e-31 112 41 3 161 3 SAV_4896 UPF0234 protein SAV_4896 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q11SS5 5.12e-31 112 41 0 162 3 CHU_2278 UPF0234 protein CHU_2278 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q1IQ21 5.24e-31 112 37 1 160 3 Acid345_2028 UPF0234 protein Acid345_2028 Koribacter versatilis (strain Ellin345)
Q30YH0 8.21e-31 112 38 0 162 3 Dde_2479 UPF0234 protein Dde_2479 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B8J7X9 1.34e-30 111 41 1 163 3 A2cp1_0112 UPF0234 protein A2cp1_0112 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B1W4U4 1.96e-30 111 43 5 165 3 SGR_2909 UPF0234 protein SGR_2909 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q3Z6X0 3.43e-30 110 33 0 162 3 DET1318 UPF0234 protein DET1318 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B4UKQ3 5.09e-30 110 41 1 163 3 AnaeK_0101 UPF0234 protein AnaeK_0101 Anaeromyxobacter sp. (strain K)
Q2JN07 2.89e-29 108 40 4 164 3 CYB_0891 UPF0234 protein CYB_0891 Synechococcus sp. (strain JA-2-3B'a(2-13))
A1SE71 4.13e-29 107 39 4 163 3 Noca_0564 UPF0234 protein Noca_0564 Nocardioides sp. (strain ATCC BAA-499 / JS614)
B1XHQ1 5.36e-29 107 38 1 160 3 SYNPCC7002_A1983 UPF0234 protein SYNPCC7002_A1983 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q2JVU4 5.66e-29 107 40 4 164 3 CYA_0935 UPF0234 protein CYA_0935 Synechococcus sp. (strain JA-3-3Ab)
Q31PX4 7.26e-28 104 35 4 164 3 Synpcc7942_0865 UPF0234 protein Synpcc7942_0865 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5N4A4 7.26e-28 104 35 4 164 3 syc0675_c UPF0234 protein syc0675_c Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
A7NIS7 9.81e-28 104 39 5 168 3 Rcas_1283 UPF0234 protein Rcas_1283 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q110Z7 9.82e-28 104 36 1 160 3 Tery_2743 UPF0234 protein Tery_2743 Trichodesmium erythraeum (strain IMS101)
Q3MBL3 5.59e-27 102 37 1 160 3 Ava_2001 UPF0234 protein Ava_2001 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B2IYY1 6.72e-27 102 38 1 160 3 Npun_R4736 UPF0234 protein Npun_R4736 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
B9LFQ7 1.93e-26 100 37 3 167 3 Chy400_2003 UPF0234 protein Chy400_2003 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WDA2 1.93e-26 100 37 3 167 3 Caur_1852 UPF0234 protein Caur_1852 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B8G9Z3 2.53e-26 100 37 3 167 3 Cagg_1607 UPF0234 protein Cagg_1607 Chloroflexus aggregans (strain MD-66 / DSM 9485)
A5UQQ1 2.56e-26 100 38 5 168 3 RoseRS_0530 UPF0234 protein RoseRS_0530 Roseiflexus sp. (strain RS-1)
Q8YNA5 2.56e-26 100 37 1 160 3 all4662 UPF0234 protein all4662 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q72U97 6.21e-26 99 33 2 162 3 LIC_10764 UPF0234 protein LIC_10764 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8F0T5 6.21e-26 99 33 2 162 3 LA_3406 UPF0234 protein LA_3406 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
B0CDF8 1.29e-25 99 37 3 163 3 AM1_1863 UPF0234 protein AM1_1863 Acaryochloris marina (strain MBIC 11017)
Q054G5 4.28e-25 97 32 2 162 3 LBL_0717 UPF0234 protein LBL_0717 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04QG7 4.28e-25 97 32 2 162 3 LBJ_2391 UPF0234 protein LBJ_2391 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
B8HNM1 8.26e-25 96 35 4 167 3 Cyan7425_1379 UPF0234 protein Cyan7425_1379 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q7U591 1.73e-24 95 36 5 166 3 SYNW1816 UPF0234 protein SYNW1816 Parasynechococcus marenigrum (strain WH8102)
Q3AWN7 1.99e-24 95 36 5 166 3 Syncc9902_1708 UPF0234 protein Syncc9902_1708 Synechococcus sp. (strain CC9902)
Q3ALV6 2.52e-24 95 35 5 166 3 Syncc9605_0652 UPF0234 protein Syncc9605_0652 Synechococcus sp. (strain CC9605)
A0LRK0 4.83e-24 94 35 4 165 3 Acel_0286 UPF0234 protein Acel_0286 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q8DKR4 5.74e-24 94 35 1 160 3 tll0793 UPF0234 protein tll0793 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7VDA4 7.73e-24 94 35 3 167 3 Pro_0479 UPF0234 protein Pro_0479 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q30UL1 2.64e-23 93 34 0 160 3 Suden_0039 UPF0234 protein Suden_0039 Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
A9BEA2 3.88e-23 92 33 5 166 3 P9211_04811 UPF0234 protein P9211_04811 Prochlorococcus marinus (strain MIT 9211)
A2C0T9 2.83e-22 90 33 6 171 3 NATL1_05371 UPF0234 protein NATL1_05371 Prochlorococcus marinus (strain NATL1A)
Q4FMS8 7.12e-22 89 36 1 163 3 SAR11_0692 UPF0234 protein SAR11_0692 Pelagibacter ubique (strain HTCC1062)
Q31C53 8.56e-22 89 35 5 166 3 PMT9312_0481 UPF0234 protein PMT9312_0481 Prochlorococcus marinus (strain MIT 9312)
Q46GU2 1.12e-21 89 32 6 171 3 PMN2A_1813 UPF0234 protein PMN2A_1813 Prochlorococcus marinus (strain NATL2A)
Q7V2J5 7.15e-21 86 34 6 166 3 PMM0481 UPF0234 protein PMM0481 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A2BPW3 1.21e-20 86 33 2 162 3 A9601_05361 UPF0234 protein A9601_05361 Prochlorococcus marinus (strain AS9601)
A3PBK4 2.07e-20 85 34 6 168 3 P9301_05061 UPF0234 protein P9301_05061 Prochlorococcus marinus (strain MIT 9301)
A2BVE2 3.93e-20 84 32 2 162 3 P9515_05441 UPF0234 protein P9515_05441 Prochlorococcus marinus (strain MIT 9515)
A8G3J6 1.18e-19 83 33 6 168 3 P9215_05621 UPF0234 protein P9215_05621 Prochlorococcus marinus (strain MIT 9215)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19585
Feature type CDS
Gene yajQ
Product YajQ family cyclic di-GMP-binding protein
Location 204 - 695 (strand: -1)
Length 492 (nucleotides) / 163 (amino acids)
In genomic island -

Contig

Accession ZDB_395
Length 4691 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2137
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04461 Protein of unknown function (DUF520)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1666 Signal transduction mechanisms (T) T Cyclic di-GMP-binding protein YajQ, UPF0234 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09767 cyclic-di-GMP-binding protein - -

Protein Sequence

MPSFDIVSEVELHEVRNAVENAQREVTSRWDFRNITATIELNEKNNSVKMTSESDFQVNQLVDIMREKLAKRGIDGASLTVPDEIVHSGKLYSVEATLLQGIDAALAKKIVKLIKDSKLKVQTQIQGEEVRVTGKSRDDLQSVMALVREGKLGQPFQFKNFRD

Flanking regions ( +/- flanking 50bp)

TTGATAAACCCGGTATTATGCCGGTCAGTTGAATATAGGGAGGTCTTCCGATGCCATCATTTGATATTGTTTCTGAAGTTGAATTACATGAAGTGCGCAATGCCGTGGAAAACGCACAGCGTGAAGTGACCAGTCGCTGGGATTTCCGCAACATTACCGCCACGATTGAGCTCAATGAGAAAAATAACAGTGTTAAAATGACCAGTGAATCTGATTTCCAGGTCAATCAGCTGGTTGATATTATGCGGGAAAAACTGGCGAAACGCGGAATTGACGGCGCGTCTCTGACGGTACCGGATGAGATTGTTCACAGCGGTAAGCTGTACAGTGTTGAGGCAACCCTGTTACAGGGGATCGATGCTGCACTGGCGAAAAAGATCGTCAAGCTGATCAAAGACAGCAAACTGAAAGTGCAGACACAAATCCAGGGTGAAGAAGTCCGGGTGACCGGCAAATCCCGTGATGATTTACAGTCTGTTATGGCACTGGTACGCGAAGGGAAACTGGGGCAGCCTTTCCAGTTCAAAAACTTCCGCGACTGAGTGTTATCCGGCAACCTGCATCAGCATGGTTGCCGGTTCCTGTCAGCTCT