Homologs in group_3513

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17950 FBDBKF_17950 100.0 Morganella morganii S1 ardC Antirestriction protein ArdC
EHELCC_06385 EHELCC_06385 100.0 Morganella morganii S2 ardC Antirestriction protein ArdC
NLDBIP_06705 NLDBIP_06705 100.0 Morganella morganii S4 ardC Antirestriction protein ArdC
HKOGLL_04685 HKOGLL_04685 100.0 Morganella morganii S5 ardC Antirestriction protein ArdC

Distribution of the homologs in the orthogroup group_3513

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3513

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P27190 1.31e-07 51 45 3 68 1 traC DNA primase TraC Escherichia coli
P27189 7.65e-06 46 41 3 67 1 traC DNA primase TraC Escherichia coli
P55426 3.78e-05 44 32 1 74 4 NGR_a03900 Uncharacterized protein y4eC Sinorhizobium fredii (strain NBRC 101917 / NGR234)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_19305
Feature type CDS
Gene ardC
Product Antirestriction protein ArdC
Location 8286 - 8633 (strand: 1)
Length 348 (nucleotides) / 115 (amino acids)
In genomic island -

Contig

Accession ZDB_390
Length 13558 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3513
Orthogroup size 5
N. genomes 5

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4227 Replication, recombination and repair (L) L Antirestriction protein ArdC

Protein Sequence

MTAIFYTILEKENDTGEIDHIPMLKTFVVFNVEQIDGLSLTADTVAPQATFDALPQAENLFCNSGANIIEKGQNAFFMPSTDEVLLPERRFFPMPLAFMPRICMRLFTGAMAKVA

Flanking regions ( +/- flanking 50bp)

ACAAACAGGCTAGGGCAGAAGGTGCGCAAGTTCGTAAGGACTAGCACGGCATGACCGCCATTTTTTATACCATCCTGGAGAAGGAAAACGACACCGGAGAAATTGACCATATCCCGATGCTGAAAACCTTTGTCGTGTTTAATGTCGAACAAATTGATGGCCTCTCACTGACGGCAGATACCGTTGCCCCACAAGCGACGTTTGACGCGTTGCCACAGGCTGAAAATCTGTTCTGTAACAGCGGTGCTAACATCATTGAGAAAGGACAAAACGCCTTTTTCATGCCATCAACAGATGAGGTTTTGTTACCTGAACGTCGTTTTTTTCCGATGCCGCTAGCTTTTATGCCACGGATCTGCATGAGATTGTTCACTGGAGCGATGGCAAAAGTCGCCTGAACCGCGAAATGAAAGGAAGATTTAGCAGTGAAAATTATGCATTTGAAGAG