Homologs in group_2380

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19150 FBDBKF_19150 100.0 Morganella morganii S1 rplO 50S ribosomal protein L15
EHELCC_18895 EHELCC_18895 100.0 Morganella morganii S2 rplO 50S ribosomal protein L15
NLDBIP_18910 NLDBIP_18910 100.0 Morganella morganii S4 rplO 50S ribosomal protein L15
HKOGLL_18500 HKOGLL_18500 100.0 Morganella morganii S5 rplO 50S ribosomal protein L15
F4V73_RS19015 F4V73_RS19015 98.6 Morganella psychrotolerans rplO 50S ribosomal protein L15
PMI_RS16245 PMI_RS16245 86.8 Proteus mirabilis HI4320 rplO 50S ribosomal protein L15

Distribution of the homologs in the orthogroup group_2380

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2380

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A1JS08 1.93e-89 259 88 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKH8 1.92e-87 254 87 0 144 3 rplO Large ribosomal subunit protein uL15 Serratia proteamaculans (strain 568)
C5BGK6 2.05e-87 254 88 0 144 3 rplO Large ribosomal subunit protein uL15 Edwardsiella ictaluri (strain 93-146)
B1JIY0 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U0 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH10 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis (strain Pestoides F)
Q1CCW3 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R913 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ93 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis
B2K518 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2W6 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL5 3.79e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B4F1K3 4.77e-87 253 86 0 144 3 rplO Large ribosomal subunit protein uL15 Proteus mirabilis (strain HI4320)
Q7MYH0 6.49e-86 250 85 0 144 3 rplO Large ribosomal subunit protein uL15 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6CZY9 1.8e-85 249 85 0 144 3 rplO Large ribosomal subunit protein uL15 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DG55 3.72e-85 248 85 0 144 3 rplO Large ribosomal subunit protein uL15 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
P46185 8.37e-85 247 85 0 144 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon kondoi
A6TEV3 2.27e-83 244 85 0 144 3 rplO Large ribosomal subunit protein uL15 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNB2 2.27e-83 244 85 0 144 3 rplO Large ribosomal subunit protein uL15 Klebsiella pneumoniae (strain 342)
B2VK77 1.13e-82 242 82 0 144 3 rplO Large ribosomal subunit protein uL15 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2NQP1 1.42e-82 241 82 0 144 3 rplO Large ribosomal subunit protein uL15 Sodalis glossinidius (strain morsitans)
P02413 1.15e-79 234 82 0 144 1 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain K12)
B1IPZ8 1.15e-79 234 82 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5A6 1.15e-79 234 82 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O9:H4 (strain HS)
B1X6F3 1.15e-79 234 82 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain K12 / DH10B)
C4ZUF6 1.15e-79 234 82 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain K12 / MC4100 / BW2952)
Q3YWV8 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella sonnei (strain Ss046)
P66075 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella flexneri
Q0T001 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella flexneri serotype 5b (strain 8401)
Q32B50 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VX5 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella boydii serotype 4 (strain Sb227)
B2U2R9 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P66073 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66074 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella typhi
B4TXC3 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella schwarzengrund (strain CVM19633)
B5BGW7 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi A (strain AKU_12601)
C0PZW4 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi C (strain RKS4594)
A9MSX9 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK03 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUS1 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella newport (strain SL254)
B4TJZ0 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella heidelberg (strain SL476)
B5RH34 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1F8 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella enteritidis PT4 (strain P125109)
B5FJJ5 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella dublin (strain CT_02021853)
Q57J51 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella choleraesuis (strain SC-B67)
B5F7S6 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella agona (strain SL483)
B7LRR7 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R630 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain UTI89 / UPEC)
B1LHB5 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain SMS-3-5 / SECEC)
B6I215 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain SE11)
B7NDS2 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P66071 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCG0 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ1 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O1:K1 / APEC
B7M106 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O8 (strain IAI1)
B7N185 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O81 (strain ED1a)
B7NLM0 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTM2 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P66072 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O157:H7
B7LI02 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain 55989 / EAEC)
B7MCR6 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK25 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSJ0 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQJ5 2.09e-79 234 81 0 144 3 rplO Large ribosomal subunit protein uL15 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MN68 7.7e-79 232 81 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WFA9 1.33e-77 229 79 0 144 3 rplO Large ribosomal subunit protein uL15 Enterobacter sp. (strain 638)
Q87SZ4 7.37e-76 224 76 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A5F561 1.12e-75 224 75 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LRN9 1.7e-75 224 75 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP03 1.7e-75 224 75 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q7MPG9 3.78e-75 223 76 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio vulnificus (strain YJ016)
Q8DE59 3.78e-75 223 76 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio vulnificus (strain CMCP6)
Q0I086 3.86e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain MR-7)
Q0HNR8 3.86e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain MR-4)
A0KRP3 3.86e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain ANA-3)
Q8EK51 3.86e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B5FGD5 5.13e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Aliivibrio fischeri (strain MJ11)
Q5E895 5.13e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1RED3 9.18e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain W3-18-1)
A4YBW4 9.18e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KWC1 9.18e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS195)
A6WHU7 9.18e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS185)
A3DA53 9.18e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI6 9.18e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS223)
A7MWH7 9.59e-75 222 75 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio campbellii (strain ATCC BAA-1116)
A3Q9A1 1.62e-74 221 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q089N5 9.59e-74 219 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella frigidimarina (strain NCIMB 400)
C4K799 1.02e-73 219 76 0 144 3 rplO Large ribosomal subunit protein uL15 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q12SU0 1.45e-73 219 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A1S237 2.44e-73 218 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B7VLD8 2.52e-73 218 75 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio atlanticus (strain LGP32)
P44353 2.78e-73 218 74 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDS8 2.78e-73 218 74 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain PittEE)
A5UHV0 4.31e-73 218 73 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain PittGG)
B6EPU4 6.32e-73 217 77 0 144 3 rplO Large ribosomal subunit protein uL15 Aliivibrio salmonicida (strain LFI1238)
B8CNF2 1.54e-72 216 75 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q65QX4 1.62e-72 216 75 0 144 3 rplO Large ribosomal subunit protein uL15 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q4QMA2 1.62e-72 216 73 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain 86-028NP)
A6VLK7 2.6e-72 216 72 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A8G1D0 1.26e-71 214 74 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sediminis (strain HAW-EB3)
Q9CL49 1.3e-71 214 74 0 144 3 rplO Large ribosomal subunit protein uL15 Pasteurella multocida (strain Pm70)
A8GYZ5 1.54e-71 214 75 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLZ3 1.54e-71 214 75 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella halifaxensis (strain HAW-EB4)
B0UX33 3.45e-71 213 72 0 144 3 rplO Large ribosomal subunit protein uL15 Histophilus somni (strain 2336)
Q0I143 3.45e-71 213 72 0 144 3 rplO Large ribosomal subunit protein uL15 Histophilus somni (strain 129Pt)
B1KMW4 6.52e-71 212 73 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella woodyi (strain ATCC 51908 / MS32)
Q6LV97 1.29e-70 211 74 0 144 3 rplO Large ribosomal subunit protein uL15 Photobacterium profundum (strain SS9)
A1T0C3 2.68e-70 211 71 0 144 3 rplO Large ribosomal subunit protein uL15 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8F6Q2 1.36e-69 209 73 0 144 3 rplO Large ribosomal subunit protein uL15 Glaesserella parasuis serovar 5 (strain SH0165)
Q493J0 3.6e-68 205 69 0 144 3 rplO Large ribosomal subunit protein uL15 Blochmanniella pennsylvanica (strain BPEN)
Q3IJK4 6.95e-68 204 70 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudoalteromonas translucida (strain TAC 125)
Q1R0F6 7.84e-68 204 68 0 144 3 rplO Large ribosomal subunit protein uL15 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C4L7U9 8.84e-68 204 73 0 144 3 rplO Large ribosomal subunit protein uL15 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q21M39 3.05e-67 203 71 0 144 3 rplO Large ribosomal subunit protein uL15 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1LTB9 9.13e-67 202 66 0 143 3 rplO Large ribosomal subunit protein uL15 Baumannia cicadellinicola subsp. Homalodisca coagulata
B8D830 1.31e-66 201 67 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57572 1.31e-66 201 67 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9S8 1.31e-66 201 67 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q7VKF2 2.1e-66 201 68 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q5QXW4 2.24e-66 201 69 0 143 3 rplO Large ribosomal subunit protein uL15 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A6W373 3.22e-66 200 68 0 144 3 rplO Large ribosomal subunit protein uL15 Marinomonas sp. (strain MWYL1)
B0BSV0 1.16e-65 199 70 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N376 1.16e-65 199 70 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3PK56 1.44e-65 199 71 0 144 3 rplO Large ribosomal subunit protein uL15 Cellvibrio japonicus (strain Ueda107)
A0KF40 6.41e-65 197 71 1 145 3 rplO Large ribosomal subunit protein uL15 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B3GZ30 8.43e-65 197 69 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q488Z4 3.1e-64 195 68 0 144 3 rplO Large ribosomal subunit protein uL15 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2S931 4.36e-64 195 65 0 144 3 rplO Large ribosomal subunit protein uL15 Hahella chejuensis (strain KCTC 2396)
A4SSY7 4.92e-64 195 70 1 145 3 rplO Large ribosomal subunit protein uL15 Aeromonas salmonicida (strain A449)
C5BQ80 6.4e-64 194 70 0 144 3 rplO Large ribosomal subunit protein uL15 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8K968 6.61e-64 194 65 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B6J5F1 1.46e-63 194 67 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain CbuK_Q154)
Q83EQ7 2.41e-63 193 67 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAY9 2.41e-63 193 67 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD12 2.41e-63 193 67 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain Dugway 5J108-111)
B6J244 2.41e-63 193 67 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain CbuG_Q212)
Q15X54 4.35e-63 192 64 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q0VSI4 7.03e-62 189 66 0 144 3 rplO Large ribosomal subunit protein uL15 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1IFU7 1.03e-61 189 66 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas entomophila (strain L48)
B1JAJ3 1.56e-61 188 66 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain W619)
Q88QL6 1.56e-61 188 66 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK86 1.56e-61 188 66 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain GB-1)
A5VXR6 1.56e-61 188 66 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5WCK9 4.91e-61 187 64 0 143 3 rplO Large ribosomal subunit protein uL15 Psychrobacter sp. (strain PRwf-1)
Q4ZMR3 7.01e-61 187 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas syringae pv. syringae (strain B728a)
Q889V2 7.01e-61 187 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D55 7.01e-61 187 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A1TYL6 1.02e-60 186 67 0 144 3 rplO Large ribosomal subunit protein uL15 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q4K552 2.12e-60 186 64 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B4RT47 2.52e-59 183 63 0 144 3 rplO Large ribosomal subunit protein uL15 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C3K2V7 6.29e-58 179 63 1 145 3 rplO Large ribosomal subunit protein uL15 Pseudomonas fluorescens (strain SBW25)
B0V6W4 1.28e-57 179 63 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain AYE)
A3M965 1.28e-57 179 63 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQT7 1.28e-57 179 63 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain SDF)
B2HZ89 1.28e-57 179 63 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain ACICU)
B7IA20 1.28e-57 179 63 0 144 1 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain AB0057)
B7GW21 1.28e-57 179 63 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain AB307-0294)
Q1H4L8 2.95e-57 177 65 0 144 3 rplO Large ribosomal subunit protein uL15 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q3K607 3.59e-57 177 63 1 145 3 rplO Large ribosomal subunit protein uL15 Pseudomonas fluorescens (strain Pf0-1)
A4VHP9 3.75e-57 177 64 0 144 3 rplO Large ribosomal subunit protein uL15 Stutzerimonas stutzeri (strain A1501)
Q6F7T1 5.55e-57 177 63 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C1DKN2 5.81e-57 177 64 0 144 3 rplO Large ribosomal subunit protein uL15 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9HWF4 1.85e-56 176 63 0 144 1 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T61 1.85e-56 176 63 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V663 1.85e-56 176 63 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain LESB58)
A6UZK7 1.85e-56 176 63 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain PA7)
A4XZ71 2.14e-56 175 63 1 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas mendocina (strain ymp)
Q0ABF6 3.74e-56 175 63 0 143 3 rplO Large ribosomal subunit protein uL15 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1QDG7 8.2e-56 174 65 0 144 3 rplO Large ribosomal subunit protein uL15 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q31IW3 1.23e-55 174 63 0 143 3 rplO Large ribosomal subunit protein uL15 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q7VQC9 1.39e-55 174 58 0 144 3 rplO Large ribosomal subunit protein uL15 Blochmanniella floridana
Q13TI9 3.3e-55 172 64 0 144 3 rplO Large ribosomal subunit protein uL15 Paraburkholderia xenovorans (strain LB400)
Q1BRW7 4.48e-55 172 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia orbicola (strain AU 1054)
B1JU41 4.48e-55 172 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia orbicola (strain MC0-3)
Q39KE8 4.48e-55 172 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0K3P4 4.48e-55 172 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia cenocepacia (strain HI2424)
B2T732 6.87e-55 172 64 0 144 3 rplO Large ribosomal subunit protein uL15 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q4FUD7 8.72e-55 171 65 0 144 3 rplO Large ribosomal subunit protein uL15 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1WVA3 1.11e-54 171 59 0 144 3 rplO Large ribosomal subunit protein uL15 Halorhodospira halophila (strain DSM 244 / SL1)
B2JI46 2.34e-54 170 63 0 144 3 rplO Large ribosomal subunit protein uL15 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A4JAQ9 3.67e-54 170 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ27 3.67e-54 170 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5D9 3.67e-54 170 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1YRP8 3.67e-54 170 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia ambifaria (strain MC40-6)
Q63Q30 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain K96243)
A3NEG0 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain 668)
Q3JMT2 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain 1710b)
A3P094 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain 1106a)
A1V884 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain SAVP1)
Q62GM4 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain ATCC 23344)
A2S7J5 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain NCTC 10229)
A3MRX3 4.23e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain NCTC 10247)
A1KRJ2 6.62e-54 169 62 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K1I2 6.62e-54 169 62 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M3U7 6.62e-54 169 62 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup C (strain 053442)
A5CXM3 8.7e-54 169 58 0 144 3 rplO Large ribosomal subunit protein uL15 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A9ADL2 2.07e-53 168 62 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia multivorans (strain ATCC 17616 / 249)
A0Q4K2 2.39e-53 167 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. novicida (strain U112)
Q2SU46 3.61e-53 167 61 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A4IZR5 3.9e-53 167 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHU9 3.9e-53 167 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JA1 3.9e-53 167 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. tularensis (strain FSC 198)
Q2YAX8 5.91e-53 167 61 0 143 3 rplO Large ribosomal subunit protein uL15 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B8GV39 5.98e-53 167 62 1 144 3 rplO Large ribosomal subunit protein uL15 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A4G9R9 6.05e-53 167 63 0 142 3 rplO Large ribosomal subunit protein uL15 Herminiimonas arsenicoxydans
B2SDW6 6.39e-53 167 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q9JX15 9.15e-53 166 61 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q89A84 1.52e-52 166 56 1 145 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0BNQ8 2.27e-52 165 58 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5F1 2.27e-52 165 58 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. holarctica (strain LVS)
A7N9U4 2.27e-52 165 58 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5F5U6 2.92e-52 165 60 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9IHS7 4.51e-52 164 67 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7VTB2 4.81e-52 164 65 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WRA4 4.81e-52 164 65 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A6T3I5 3.24e-51 162 61 0 142 3 rplO Large ribosomal subunit protein uL15 Janthinobacterium sp. (strain Marseille)
B0U0X0 6.25e-51 162 55 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q7W2D6 7.33e-51 161 64 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
B3R7E9 8.39e-51 161 64 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A5IHP6 1.75e-50 160 57 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila (strain Corby)
Q2L260 4.13e-50 159 64 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella avium (strain 197N)
Q46WG3 4.62e-50 159 64 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3SLN0 4.67e-50 159 60 0 144 3 rplO Large ribosomal subunit protein uL15 Thiobacillus denitrificans (strain ATCC 25259)
Q0K638 5.04e-50 159 64 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q5WZJ3 7e-50 159 57 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila (strain Lens)
Q5ZYM4 7e-50 159 57 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X840 7e-50 159 57 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila (strain Paris)
Q1LI56 2.07e-49 158 63 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q3J8T2 2.46e-49 157 57 0 144 3 rplO Large ribosomal subunit protein uL15 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q057C3 2.29e-48 155 53 1 145 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q5P313 3.62e-48 155 60 0 142 3 rplO Large ribosomal subunit protein uL15 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B2UEK0 7.64e-48 154 62 0 128 3 rplO Large ribosomal subunit protein uL15 Ralstonia pickettii (strain 12J)
Q8XV31 4.49e-47 152 63 0 128 3 rplO Large ribosomal subunit protein uL15 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q12G84 8.65e-47 151 56 0 142 3 rplO Large ribosomal subunit protein uL15 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q7NQH1 9.04e-47 151 61 0 128 3 rplO Large ribosomal subunit protein uL15 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q47J84 2.09e-46 150 56 0 144 3 rplO Large ribosomal subunit protein uL15 Dechloromonas aromatica (strain RCB)
Q8D1Z3 2.66e-46 150 53 1 144 3 rplO Large ribosomal subunit protein uL15 Wigglesworthia glossinidia brevipalpis
A5EX99 6.89e-46 149 59 0 128 3 rplO Large ribosomal subunit protein uL15 Dichelobacter nodosus (strain VCS1703A)
A2SLD8 1.87e-45 148 57 0 128 3 rplO Large ribosomal subunit protein uL15 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A1VJ34 1.22e-44 145 54 0 142 3 rplO Large ribosomal subunit protein uL15 Polaromonas naphthalenivorans (strain CJ2)
B5ELZ8 2.37e-44 145 55 1 145 3 rplO Large ribosomal subunit protein uL15 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J486 2.37e-44 145 55 1 145 3 rplO Large ribosomal subunit protein uL15 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
C1DAT6 4.43e-44 144 60 0 128 3 rplO Large ribosomal subunit protein uL15 Laribacter hongkongensis (strain HLHK9)
A0PXW5 1.12e-43 143 55 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium novyi (strain NT)
Q67JW2 1.75e-43 143 55 2 145 3 rplO Large ribosomal subunit protein uL15 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B1Y8B8 4.49e-43 142 57 0 128 3 rplO Large ribosomal subunit protein uL15 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A1TJT6 5.41e-43 141 59 0 128 3 rplO Large ribosomal subunit protein uL15 Paracidovorax citrulli (strain AAC00-1)
B8FER6 6.91e-43 141 53 1 144 3 rplO Large ribosomal subunit protein uL15 Desulfatibacillum aliphaticivorans
A4SUY0 2.25e-42 140 60 0 128 3 rplO Large ribosomal subunit protein uL15 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1WK97 6.67e-42 139 58 0 128 3 rplO Large ribosomal subunit protein uL15 Verminephrobacter eiseniae (strain EF01-2)
A6LPT0 1.13e-41 138 52 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B2UYC9 8.71e-41 136 52 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Alaska E43 / Type E3)
B2TIJ4 1.12e-40 135 52 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Eklund 17B / Type B)
Q04BZ6 1.13e-40 135 49 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBJ9 1.13e-40 135 49 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A9BRX0 1.48e-40 135 55 0 128 3 rplO Large ribosomal subunit protein uL15 Delftia acidovorans (strain DSM 14801 / SPH-1)
C6E4N8 1.83e-40 135 50 1 145 3 rplO Large ribosomal subunit protein uL15 Geobacter sp. (strain M21)
B5EFR9 1.83e-40 135 50 1 145 3 rplO Large ribosomal subunit protein uL15 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B8I7Z8 1.84e-40 135 51 2 145 3 rplO Large ribosomal subunit protein uL15 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B1XSS0 2.18e-40 135 58 0 144 3 rplO Large ribosomal subunit protein uL15 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A5GAW1 2.25e-40 135 46 1 145 3 rplO Large ribosomal subunit protein uL15 Geotalea uraniireducens (strain Rf4)
A1W327 3.55e-40 134 56 0 128 3 rplO Large ribosomal subunit protein uL15 Acidovorax sp. (strain JS42)
B9MBV6 3.55e-40 134 56 0 128 3 rplO Large ribosomal subunit protein uL15 Acidovorax ebreus (strain TPSY)
A3DJJ1 8.52e-40 133 52 1 144 3 rplO Large ribosomal subunit protein uL15 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A1KB08 1.08e-39 133 59 0 123 3 rplO Large ribosomal subunit protein uL15 Azoarcus sp. (strain BH72)
Q6XYX0 1.37e-39 133 47 0 143 3 rplO Large ribosomal subunit protein uL15 Spiroplasma kunkelii
Q0AIH7 2.86e-39 132 51 3 145 3 rplO Large ribosomal subunit protein uL15 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q87E63 3.47e-39 132 50 1 145 3 rplO Large ribosomal subunit protein uL15 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
C5CQ81 3.91e-39 132 54 0 128 3 rplO Large ribosomal subunit protein uL15 Variovorax paradoxus (strain S110)
B9M6F9 4.23e-39 132 45 1 145 3 rplO Large ribosomal subunit protein uL15 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q21QP2 8.31e-39 131 52 0 142 3 rplO Large ribosomal subunit protein uL15 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6F1X6 9.42e-39 131 50 0 143 3 rplO Large ribosomal subunit protein uL15 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q9PE57 1.46e-38 130 49 1 145 3 rplO Large ribosomal subunit protein uL15 Xylella fastidiosa (strain 9a5c)
Q3A6M8 1.9e-38 130 51 1 145 3 rplO Large ribosomal subunit protein uL15 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
P10138 5.33e-38 129 48 0 143 3 rplO Large ribosomal subunit protein uL15 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
A4XLR2 1.09e-37 128 53 3 146 3 rplO Large ribosomal subunit protein uL15 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q0SQG3 1.18e-37 128 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium perfringens (strain SM101 / Type A)
Q8XHU2 1.18e-37 128 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium perfringens (strain 13 / Type A)
Q0TMR5 1.18e-37 128 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2RFR6 1.34e-37 128 51 1 144 3 rplO Large ribosomal subunit protein uL15 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
B4UBB8 1.39e-37 128 54 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter sp. (strain K)
B8J879 1.39e-37 128 54 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IJ68 1.42e-37 128 54 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter dehalogenans (strain 2CP-C)
A8ZV76 2.69e-37 127 51 1 144 3 rplO Large ribosomal subunit protein uL15 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q839E5 3.25e-37 127 50 1 144 1 rplO Large ribosomal subunit protein uL15 Enterococcus faecalis (strain ATCC 700802 / V583)
A5N4R6 3.51e-37 127 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYC8 3.51e-37 127 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium kluyveri (strain NBRC 12016)
B1I1L8 5.42e-37 126 50 1 144 3 rplO Large ribosomal subunit protein uL15 Desulforudis audaxviator (strain MP104C)
A8MLF9 5.59e-37 126 54 3 146 3 rplO Large ribosomal subunit protein uL15 Alkaliphilus oremlandii (strain OhILAs)
Q6MSP3 8.51e-37 126 48 0 143 3 rplO Large ribosomal subunit protein uL15 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
A5D5H4 9.35e-37 125 50 1 144 3 rplO Large ribosomal subunit protein uL15 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
C0ZIJ9 9.77e-37 125 50 1 144 3 rplO Large ribosomal subunit protein uL15 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q82X73 1.41e-36 125 48 1 144 3 rplO Large ribosomal subunit protein uL15 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B3E849 1.78e-36 125 47 1 144 3 rplO Large ribosomal subunit protein uL15 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B8G1Y5 1.93e-36 125 48 1 145 3 rplO Large ribosomal subunit protein uL15 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B0RZS8 2.17e-36 125 50 3 147 3 rplO Large ribosomal subunit protein uL15 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q250L3 2.18e-36 125 48 1 145 3 rplO Large ribosomal subunit protein uL15 Desulfitobacterium hafniense (strain Y51)
B9MKG3 3.41e-36 124 51 3 146 3 rplO Large ribosomal subunit protein uL15 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q81J23 3.94e-36 124 49 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HJ67 3.94e-36 124 49 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain B4264)
B3E0K2 4.11e-36 124 50 1 144 3 rplO Large ribosomal subunit protein uL15 Methylacidiphilum infernorum (isolate V4)
Q6HPN9 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H71 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain ZK / E33L)
B9IZL3 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain Q1)
B7HQW3 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain AH187)
C1ET58 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain 03BB102)
Q73F77 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKD8 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain AH820)
Q81VR1 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus anthracis
A0R8J9 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus thuringiensis (strain Al Hakam)
C3LJA1 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9S4 6.16e-36 124 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus anthracis (strain A0248)
A9VP96 7.92e-36 123 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus mycoides (strain KBAB4)
C1FMT2 9.74e-36 123 51 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Kyoto / Type A2)
A5I7I7 9.74e-36 123 51 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVN2 9.74e-36 123 51 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain 657 / Type Ba4)
A7FQ41 9.74e-36 123 51 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain ATCC 19397 / Type A)
Q97EJ7 1.4e-35 123 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B1IGD5 1.44e-35 123 51 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Okra / Type B1)
Q890Q3 1.89e-35 122 51 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium tetani (strain Massachusetts / E88)
B7IT38 2.49e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain G9842)
A7GK39 2.51e-35 122 48 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8E2B5 2.6e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7S2 2.6e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3V0 2.6e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A7GJ55 2.8e-35 122 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C0ME24 3.09e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U519 3.09e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MBW6 3.09e-35 122 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus equi subsp. equi (strain 4047)
Q8PC34 3.18e-35 122 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URF8 3.18e-35 122 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas campestris pv. campestris (strain 8004)
B1KSK6 4.29e-35 121 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Loch Maree / Type A3)
A9NEF2 4.43e-35 121 43 1 144 3 rplO Large ribosomal subunit protein uL15 Acholeplasma laidlawii (strain PG-8A)
A4IJK7 4.73e-35 121 48 1 144 3 rplO Large ribosomal subunit protein uL15 Geobacillus thermodenitrificans (strain NG80-2)
A6TWG3 4.87e-35 121 52 3 146 3 rplO Large ribosomal subunit protein uL15 Alkaliphilus metalliredigens (strain QYMF)
Q3BWW4 5.49e-35 121 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P38373 6.21e-35 121 48 1 144 3 rplO Large ribosomal subunit protein uL15 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q39XY7 7.5e-35 121 46 1 145 3 rplO Large ribosomal subunit protein uL15 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8PNQ9 8.57e-35 121 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas axonopodis pv. citri (strain 306)
B2A4F8 9.49e-35 120 49 3 147 3 rplO Large ribosomal subunit protein uL15 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q03IH0 1.08e-34 120 48 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M2D2 1.09e-34 120 48 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXT0 1.09e-34 120 48 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus thermophilus (strain CNRZ 1066)
P35138 1.13e-34 120 47 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2P004 1.43e-34 120 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3A9T5 1.55e-34 120 48 1 144 3 rplO Large ribosomal subunit protein uL15 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q5GWV4 1.88e-34 120 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B9DSW9 1.97e-34 120 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q8R7X2 2.03e-34 120 47 1 145 3 rplO Large ribosomal subunit protein uL15 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B7GJ86 2.4e-34 120 48 1 144 3 rplO Large ribosomal subunit protein uL15 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
C1CPA7 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIB6 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain P1031)
C1CC25 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain JJA)
Q8CWV0 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS59 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain CGSP14)
Q97SU3 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKP9 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8L7 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAN1 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain 70585)
B5E6H4 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae serotype 19F (strain G54)
Q04ML7 2.98e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A4J130 3.83e-34 119 51 3 145 3 rplO Large ribosomal subunit protein uL15 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
P19946 5.02e-34 119 46 1 144 1 rplO Large ribosomal subunit protein uL15 Bacillus subtilis (strain 168)
Q8DS31 6.81e-34 119 47 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C4KZM7 1.58e-33 117 45 1 144 3 rplO Large ribosomal subunit protein uL15 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B5XJ55 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE07 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT0 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC33 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Z4 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ43 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JNZ8 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE40 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNP1 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEB6 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE06 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1V5 1.66e-33 117 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M1
B0K5R1 2.13e-33 117 47 1 145 3 rplO Large ribosomal subunit protein uL15 Thermoanaerobacter sp. (strain X514)
B0KCL8 2.13e-33 117 47 1 145 3 rplO Large ribosomal subunit protein uL15 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C5D3T6 2.28e-33 117 47 1 144 3 rplO Large ribosomal subunit protein uL15 Geobacillus sp. (strain WCH70)
P04452 2.72e-33 117 47 1 144 1 rplO Large ribosomal subunit protein uL15 Geobacillus stearothermophilus
Q5L3S0 2.72e-33 117 47 1 144 3 rplO Large ribosomal subunit protein uL15 Geobacillus kaustophilus (strain HTA426)
Q749A6 2.91e-33 117 48 1 145 3 rplO Large ribosomal subunit protein uL15 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A7Z0Q7 2.93e-33 117 45 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q03ED5 3.15e-33 117 47 2 144 3 rplO Large ribosomal subunit protein uL15 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A8AZK6 5.16e-33 116 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1YGW9 6.01e-33 116 45 1 144 3 rplO Large ribosomal subunit protein uL15 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A8F9A4 6.42e-33 116 46 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus pumilus (strain SAFR-032)
Q605D1 7.13e-33 116 53 0 143 3 rplO Large ribosomal subunit protein uL15 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5WLP3 7.64e-33 116 46 3 154 3 rplO Large ribosomal subunit protein uL15 Shouchella clausii (strain KSM-K16)
A7HBN7 8.05e-33 116 51 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter sp. (strain Fw109-5)
B1HMW1 9.09e-33 115 46 1 144 3 rplO Large ribosomal subunit protein uL15 Lysinibacillus sphaericus (strain C3-41)
A3CK83 1.09e-32 115 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus sanguinis (strain SK36)
Q18CH7 1.43e-32 115 48 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridioides difficile (strain 630)
Q0AUJ9 2.03e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A1ALW0 2.09e-32 115 44 1 145 3 rplO Large ribosomal subunit protein uL15 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B9E9L0 2.42e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Macrococcus caseolyticus (strain JCSC5402)
Q1D756 2.57e-32 115 47 1 144 3 rplO Large ribosomal subunit protein uL15 Myxococcus xanthus (strain DK1622)
B0TC75 3.89e-32 114 50 2 145 3 rplO Large ribosomal subunit protein uL15 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q1AU48 8.99e-32 113 46 2 150 3 rplO Large ribosomal subunit protein uL15 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
C4ZBT7 1.12e-31 113 46 3 145 3 rplO Large ribosomal subunit protein uL15 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B2UQM8 2.24e-31 112 44 2 145 3 rplO Large ribosomal subunit protein uL15 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
Q6AP51 3.07e-31 112 44 2 149 3 rplO Large ribosomal subunit protein uL15 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8RIH5 3.98e-31 112 42 2 146 3 rplO Large ribosomal subunit protein uL15 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P0A0F7 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain MW2)
A8Z338 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G790 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain MSSA476)
Q6GEK2 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain MRSA252)
P0A0F6 7.6e-31 110 43 1 144 1 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain N315)
P0A0F5 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ73 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain Newman)
Q5HDX7 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain COL)
Q2YYL6 7.6e-31 110 43 1 144 1 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV15 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain JH9)
P0A0F8 7.6e-31 110 43 1 144 1 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEQ8 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain USA300)
A6U3V6 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain JH1)
A7X5D4 7.6e-31 110 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q046A7 7.94e-31 110 45 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q6MJ31 8.24e-31 110 52 3 142 3 rplO Large ribosomal subunit protein uL15 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
C0Q9V4 9.19e-31 110 50 1 144 3 rplO Large ribosomal subunit protein uL15 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q7UN02 1.72e-30 110 43 3 147 3 rplO Large ribosomal subunit protein uL15 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8ETW5 2.36e-30 109 45 1 144 3 rplO Large ribosomal subunit protein uL15 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8KAJ0 3e-30 110 48 3 150 3 rplO Large ribosomal subunit protein uL15 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q74L71 3.84e-30 109 44 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A5V5Y3 4.2e-30 110 48 2 150 3 rplO Large ribosomal subunit protein uL15 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q03ZM7 1.48e-29 107 45 2 144 3 rplO Large ribosomal subunit protein uL15 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q1ISA3 1.87e-29 107 48 4 147 3 rplO Large ribosomal subunit protein uL15 Koribacter versatilis (strain Ellin345)
B1VAC9 2.27e-29 107 43 1 142 3 rplO Large ribosomal subunit protein uL15 Phytoplasma australiense
B5Y969 2.45e-29 107 43 3 149 3 rplO Large ribosomal subunit protein uL15 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q04G67 2.76e-29 107 40 1 143 3 rplO Large ribosomal subunit protein uL15 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A7HM33 2.84e-29 107 42 1 145 3 rplO Large ribosomal subunit protein uL15 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
B1MVZ6 3.26e-29 106 45 2 144 3 rplO Large ribosomal subunit protein uL15 Leuconostoc citreum (strain KM20)
A8F4T0 4.43e-29 106 44 1 144 3 rplO Large ribosomal subunit protein uL15 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q2NIX3 5.18e-29 106 42 1 142 3 rplO Large ribosomal subunit protein uL15 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q6FZE1 9.19e-29 105 46 2 149 3 rplO Large ribosomal subunit protein uL15 Bartonella quintana (strain Toulouse)
Q73PL3 1.53e-28 105 41 2 145 3 rplO Large ribosomal subunit protein uL15 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q8Y447 1.63e-28 105 45 1 144 1 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB27 1.63e-28 105 45 1 144 3 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WG5 1.63e-28 105 45 1 144 3 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serotype 4b (strain F2365)
C1KZG1 1.63e-28 105 45 1 144 3 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serotype 4b (strain CLIP80459)
A0ALU9 1.78e-28 105 45 1 144 3 rplO Large ribosomal subunit protein uL15 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B3QR90 2.45e-28 105 46 3 149 3 rplO Large ribosomal subunit protein uL15 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A6LLN2 2.53e-28 104 42 1 145 3 rplO Large ribosomal subunit protein uL15 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q927M6 2.74e-28 104 45 1 144 3 rplO Large ribosomal subunit protein uL15 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B5YG29 3.06e-28 104 42 2 146 3 rplO Large ribosomal subunit protein uL15 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q38UT0 3.23e-28 104 47 2 144 3 rplO Large ribosomal subunit protein uL15 Latilactobacillus sakei subsp. sakei (strain 23K)
Q49ZE9 3.52e-28 104 42 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q3ZZQ5 3.91e-28 104 43 3 146 3 rplO Large ribosomal subunit protein uL15 Dehalococcoides mccartyi (strain CBDB1)
A5FRW3 3.91e-28 104 43 3 146 3 rplO Large ribosomal subunit protein uL15 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B3QYE3 4.02e-28 105 44 4 147 3 rplO Large ribosomal subunit protein uL15 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q3Z962 4.5e-28 104 43 3 146 3 rplO Large ribosomal subunit protein uL15 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
B7IHW5 8.62e-28 103 42 1 145 3 rplO Large ribosomal subunit protein uL15 Thermosipho africanus (strain TCF52B)
Q3B6E3 8.86e-28 104 48 5 149 3 rplO Large ribosomal subunit protein uL15 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B8IYL0 1.18e-27 103 44 4 149 3 rplO Large ribosomal subunit protein uL15 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q11HS1 1.5e-27 102 48 4 154 3 rplO Large ribosomal subunit protein uL15 Chelativorans sp. (strain BNC1)
O67561 1.88e-27 102 44 3 146 3 rplO Large ribosomal subunit protein uL15 Aquifex aeolicus (strain VF5)
Q1WSA9 1.95e-27 102 43 2 144 3 rplO Large ribosomal subunit protein uL15 Ligilactobacillus salivarius (strain UCC118)
B3R010 2.09e-27 102 39 2 143 3 rplO Large ribosomal subunit protein uL15 Phytoplasma mali (strain AT)
Q8G090 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella suis biovar 1 (strain 1330)
B0CH13 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQY7 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YHM1 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJI2 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5N1 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CS7 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella abortus biovar 1 (strain 9-941)
Q2YRT5 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella abortus (strain 2308)
B2S660 3.08e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella abortus (strain S19)
A6X0D7 3.59e-27 102 46 2 150 3 rplO Large ribosomal subunit protein uL15 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q3APJ2 3.77e-27 102 45 4 145 3 rplO Large ribosomal subunit protein uL15 Chlorobium chlorochromatii (strain CaD3)
A1BJ15 4.49e-27 102 45 3 148 3 rplO Large ribosomal subunit protein uL15 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B4SBW6 6.46e-27 102 43 5 151 3 rplO Large ribosomal subunit protein uL15 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q07KN7 6.46e-27 101 45 3 151 3 rplO Large ribosomal subunit protein uL15 Rhodopseudomonas palustris (strain BisA53)
Q01WB1 6.52e-27 101 42 0 140 3 rplO Large ribosomal subunit protein uL15 Solibacter usitatus (strain Ellin6076)
P35139 6.59e-27 100 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus carnosus (strain TM300)
B8D0E2 7.47e-27 100 45 2 155 3 rplO Large ribosomal subunit protein uL15 Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q2LQB8 7.8e-27 100 48 3 147 3 rplO Large ribosomal subunit protein uL15 Syntrophus aciditrophicus (strain SB)
A9KJH5 1.5e-26 100 44 3 145 3 rplO Large ribosomal subunit protein uL15 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q2K9J7 1.69e-26 100 44 2 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B1LBM1 1.94e-26 99 41 1 145 3 rplO Large ribosomal subunit protein uL15 Thermotoga sp. (strain RQ2)
A5IMA2 1.94e-26 99 41 1 145 3 rplO Large ribosomal subunit protein uL15 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A9IW02 2.04e-26 100 42 3 150 3 rplO Large ribosomal subunit protein uL15 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q1IX91 2.31e-26 99 44 3 143 3 rplO Large ribosomal subunit protein uL15 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B3PWU0 3.26e-26 99 44 2 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium etli (strain CIAT 652)
Q6G2Y4 3.69e-26 99 44 3 150 3 rplO Large ribosomal subunit protein uL15 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B5ZYV4 3.76e-26 99 44 2 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B2GDV0 3.78e-26 99 45 2 144 3 rplO Large ribosomal subunit protein uL15 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B0UHV0 4.7e-26 99 43 2 151 3 rplO Large ribosomal subunit protein uL15 Methylobacterium sp. (strain 4-46)
Q2G8W1 6.13e-26 99 44 3 149 3 rplO Large ribosomal subunit protein uL15 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q5FM72 6.28e-26 98 43 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A1B047 6.83e-26 99 44 3 150 3 rplO Large ribosomal subunit protein uL15 Paracoccus denitrificans (strain Pd 1222)
A8YXM4 7.16e-26 98 42 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus helveticus (strain DPC 4571)
B1LWQ7 7.65e-26 99 42 2 149 3 rplO Large ribosomal subunit protein uL15 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B2ITN8 8.56e-26 98 42 2 145 3 rplO Large ribosomal subunit protein uL15 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A9H3K5 8.61e-26 98 42 4 150 3 rplO Large ribosomal subunit protein uL15 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q9X1J0 8.93e-26 98 41 1 145 3 rplO Large ribosomal subunit protein uL15 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B8ISA4 9.5e-26 98 42 2 151 3 rplO Large ribosomal subunit protein uL15 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q1MIC2 1.04e-25 98 43 2 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P58121 1.42e-25 97 48 1 118 3 rplO Large ribosomal subunit protein uL15 Lactococcus lactis subsp. lactis (strain IL1403)
B9JVQ6 1.48e-25 97 45 2 151 3 rplO Large ribosomal subunit protein uL15 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18765
Feature type CDS
Gene rplO
Product 50S ribosomal protein L15
Location 14245 - 14679 (strand: -1)
Length 435 (nucleotides) / 144 (amino acids)

Contig

Accession ZDB_385
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2380
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00828 Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0200 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L15

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02876 large subunit ribosomal protein L15 Ribosome -

Protein Sequence

MQLNTLSPAAGAKHAPKRVGRGIGSGLGKTAGRGHKGQSSRSGGGVRRGFEGGQMPLYRRLPKFGFTSRKAMVTAEIRLSDLQLIEGDVIDLNVLKAANVIGPQIEYAKVFLSGELTRAVTVRGLRVTKGARAVIEAAGGKIEE

Flanking regions ( +/- flanking 50bp)

GTGGTATGGTTAATCGTATTTCCTATATGGTTAAAGTTGAGGAGTAACAGATGCAATTAAATACTCTGTCTCCGGCAGCAGGTGCTAAACACGCACCAAAACGTGTAGGTCGTGGTATTGGTTCCGGTCTCGGTAAAACCGCAGGTCGTGGTCACAAAGGTCAGAGCTCTCGTTCTGGCGGTGGCGTACGTCGTGGGTTTGAAGGTGGCCAGATGCCTTTATATCGTCGTCTGCCAAAATTCGGCTTTACTTCACGTAAAGCGATGGTCACTGCTGAGATCCGTTTATCTGATCTTCAGCTGATCGAAGGCGATGTTATCGATCTTAATGTATTGAAAGCCGCAAACGTTATTGGTCCACAGATTGAGTACGCGAAAGTGTTCCTGTCTGGTGAACTGACTCGTGCAGTTACTGTACGCGGCCTGCGTGTTACTAAAGGCGCTCGTGCTGTTATCGAAGCTGCTGGCGGTAAAATCGAGGAATAAGTAACAGATGGCAAAGCAACCAGGTACAGATTTCCAAAGTGCTAAAGGCG