Homologs in group_2413

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19150 FBDBKF_19150 86.8 Morganella morganii S1 rplO 50S ribosomal protein L15
EHELCC_18895 EHELCC_18895 86.8 Morganella morganii S2 rplO 50S ribosomal protein L15
NLDBIP_18910 NLDBIP_18910 86.8 Morganella morganii S4 rplO 50S ribosomal protein L15
LHKJJB_18765 LHKJJB_18765 86.8 Morganella morganii S3 rplO 50S ribosomal protein L15
HKOGLL_18500 HKOGLL_18500 86.8 Morganella morganii S5 rplO 50S ribosomal protein L15
F4V73_RS19015 F4V73_RS19015 85.4 Morganella psychrotolerans rplO 50S ribosomal protein L15

Distribution of the homologs in the orthogroup group_2413

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2413

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F1K3 1.35e-98 282 100 0 144 3 rplO Large ribosomal subunit protein uL15 Proteus mirabilis (strain HI4320)
Q7MYH0 1.87e-90 261 89 0 144 3 rplO Large ribosomal subunit protein uL15 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BGK6 2.21e-89 259 88 0 144 3 rplO Large ribosomal subunit protein uL15 Edwardsiella ictaluri (strain 93-146)
B1JIY0 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664U0 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH10 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis (strain Pestoides F)
Q1CCW3 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R913 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ93 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis
B2K518 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2W6 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL5 3.7e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JS08 5.31e-89 258 88 0 144 3 rplO Large ribosomal subunit protein uL15 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DG55 5.37e-89 258 89 0 144 3 rplO Large ribosomal subunit protein uL15 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NQP1 2.34e-88 256 89 0 144 3 rplO Large ribosomal subunit protein uL15 Sodalis glossinidius (strain morsitans)
Q6CZY9 3.7e-88 256 88 0 144 3 rplO Large ribosomal subunit protein uL15 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P46185 6.13e-88 255 89 0 144 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon kondoi
A8GKH8 1.68e-87 254 88 0 144 3 rplO Large ribosomal subunit protein uL15 Serratia proteamaculans (strain 568)
A6TEV3 2.98e-87 253 88 0 144 3 rplO Large ribosomal subunit protein uL15 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XNB2 2.98e-87 253 88 0 144 3 rplO Large ribosomal subunit protein uL15 Klebsiella pneumoniae (strain 342)
B2VK77 3.67e-85 248 85 0 144 3 rplO Large ribosomal subunit protein uL15 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
P02413 5.41e-83 243 85 0 144 1 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain K12)
B1IPZ8 5.41e-83 243 85 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A5A6 5.41e-83 243 85 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O9:H4 (strain HS)
B1X6F3 5.41e-83 243 85 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain K12 / DH10B)
C4ZUF6 5.41e-83 243 85 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain K12 / MC4100 / BW2952)
Q3YWV8 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella sonnei (strain Ss046)
P66075 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella flexneri
Q0T001 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella flexneri serotype 5b (strain 8401)
Q32B50 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella dysenteriae serotype 1 (strain Sd197)
Q31VX5 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella boydii serotype 4 (strain Sb227)
B2U2R9 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P66073 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66074 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella typhi
B4TXC3 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella schwarzengrund (strain CVM19633)
B5BGW7 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi A (strain AKU_12601)
C0PZW4 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi C (strain RKS4594)
A9MSX9 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK03 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUS1 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella newport (strain SL254)
B4TJZ0 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella heidelberg (strain SL476)
B5RH34 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R1F8 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella enteritidis PT4 (strain P125109)
B5FJJ5 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella dublin (strain CT_02021853)
Q57J51 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella choleraesuis (strain SC-B67)
B5F7S6 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella agona (strain SL483)
B7LRR7 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R630 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain UTI89 / UPEC)
B1LHB5 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain SMS-3-5 / SECEC)
B6I215 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain SE11)
B7NDS2 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P66071 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCG0 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ1 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O1:K1 / APEC
B7M106 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O8 (strain IAI1)
B7N185 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O81 (strain ED1a)
B7NLM0 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTM2 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P66072 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O157:H7
B7LI02 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli (strain 55989 / EAEC)
B7MCR6 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UK25 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSJ0 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQJ5 9.67e-83 242 84 0 144 3 rplO Large ribosomal subunit protein uL15 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A9MN68 3.73e-82 241 84 0 144 3 rplO Large ribosomal subunit protein uL15 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WFA9 1.23e-81 239 84 0 144 3 rplO Large ribosomal subunit protein uL15 Enterobacter sp. (strain 638)
C3LRN9 2.02e-81 239 81 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP03 2.02e-81 239 81 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F561 1.48e-80 236 80 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87SZ4 2.9e-80 236 79 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MPG9 3.34e-79 233 79 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio vulnificus (strain YJ016)
Q8DE59 3.34e-79 233 79 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio vulnificus (strain CMCP6)
A7MWH7 4.65e-79 233 78 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio campbellii (strain ATCC BAA-1116)
A5UHV0 1.87e-78 231 79 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain PittGG)
P44353 3.46e-78 231 79 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDS8 3.46e-78 231 79 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain PittEE)
B5FGD5 3.86e-78 230 80 0 144 3 rplO Large ribosomal subunit protein uL15 Aliivibrio fischeri (strain MJ11)
Q5E895 3.86e-78 230 80 0 144 3 rplO Large ribosomal subunit protein uL15 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6VLK7 7.53e-78 229 77 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QMA2 2.28e-77 228 78 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus influenzae (strain 86-028NP)
Q9CL49 5.13e-77 228 78 0 144 3 rplO Large ribosomal subunit protein uL15 Pasteurella multocida (strain Pm70)
Q0I086 2.57e-76 226 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain MR-7)
Q0HNR8 2.57e-76 226 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain MR-4)
A0KRP3 2.57e-76 226 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain ANA-3)
Q8EK51 2.57e-76 226 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B7VLD8 3.07e-76 226 77 0 144 3 rplO Large ribosomal subunit protein uL15 Vibrio atlanticus (strain LGP32)
B6EPU4 3.82e-76 225 79 0 144 3 rplO Large ribosomal subunit protein uL15 Aliivibrio salmonicida (strain LFI1238)
B0UX33 5.08e-76 225 79 0 144 3 rplO Large ribosomal subunit protein uL15 Histophilus somni (strain 2336)
Q0I143 5.08e-76 225 79 0 144 3 rplO Large ribosomal subunit protein uL15 Histophilus somni (strain 129Pt)
Q65QX4 5.67e-76 225 76 0 144 3 rplO Large ribosomal subunit protein uL15 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A1RED3 6.68e-76 225 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sp. (strain W3-18-1)
A4YBW4 6.68e-76 225 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KWC1 6.68e-76 225 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS195)
A6WHU7 6.68e-76 225 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS185)
A3DA53 6.68e-76 225 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI6 6.68e-76 225 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella baltica (strain OS223)
A1S237 7.06e-76 225 80 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q089N5 9.28e-76 224 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella frigidimarina (strain NCIMB 400)
A3Q9A1 3.58e-75 223 78 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q12SU0 9.08e-75 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B8CNF2 1.04e-74 222 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella piezotolerans (strain WP3 / JCM 13877)
B8F6Q2 4.08e-74 220 77 0 144 3 rplO Large ribosomal subunit protein uL15 Glaesserella parasuis serovar 5 (strain SH0165)
A8G1D0 4.35e-74 220 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella sediminis (strain HAW-EB3)
A8GYZ5 4.75e-74 220 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TLZ3 4.75e-74 220 77 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella halifaxensis (strain HAW-EB4)
C4K799 5.79e-74 220 76 0 144 3 rplO Large ribosomal subunit protein uL15 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q6LV97 5.79e-73 217 76 0 144 3 rplO Large ribosomal subunit protein uL15 Photobacterium profundum (strain SS9)
B1KMW4 5.02e-72 215 75 0 144 3 rplO Large ribosomal subunit protein uL15 Shewanella woodyi (strain ATCC 51908 / MS32)
Q7VKF2 6.25e-72 215 74 0 144 3 rplO Large ribosomal subunit protein uL15 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BSV0 1.23e-71 214 74 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N376 1.23e-71 214 74 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3IJK4 1.5e-71 214 74 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudoalteromonas translucida (strain TAC 125)
A1T0C3 2.46e-71 213 72 0 144 3 rplO Large ribosomal subunit protein uL15 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B3GZ30 8.12e-71 212 73 0 144 3 rplO Large ribosomal subunit protein uL15 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q1R0F6 8.49e-71 212 70 0 144 3 rplO Large ribosomal subunit protein uL15 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q493J0 1.53e-70 211 72 0 144 3 rplO Large ribosomal subunit protein uL15 Blochmanniella pennsylvanica (strain BPEN)
C4L7U9 4.74e-70 210 75 0 144 3 rplO Large ribosomal subunit protein uL15 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6W373 5.41e-70 210 71 0 144 3 rplO Large ribosomal subunit protein uL15 Marinomonas sp. (strain MWYL1)
Q1LTB9 6.58e-68 204 66 0 143 3 rplO Large ribosomal subunit protein uL15 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q15X54 1.58e-66 201 69 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q0VSI4 1.69e-66 201 70 0 144 3 rplO Large ribosomal subunit protein uL15 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5QXW4 2.27e-66 201 70 0 143 3 rplO Large ribosomal subunit protein uL15 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A0KF40 3.15e-66 200 72 1 145 3 rplO Large ribosomal subunit protein uL15 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SSY7 3.4e-66 200 73 1 145 3 rplO Large ribosomal subunit protein uL15 Aeromonas salmonicida (strain A449)
B8D830 3.4e-66 200 66 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57572 3.4e-66 200 66 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9S8 3.4e-66 200 66 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B4RT47 4.57e-66 200 69 0 144 3 rplO Large ribosomal subunit protein uL15 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q21M39 6.63e-66 199 71 0 144 3 rplO Large ribosomal subunit protein uL15 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2S931 3.51e-65 197 67 0 144 3 rplO Large ribosomal subunit protein uL15 Hahella chejuensis (strain KCTC 2396)
B3PK56 7.72e-65 197 70 0 144 3 rplO Large ribosomal subunit protein uL15 Cellvibrio japonicus (strain Ueda107)
Q488Z4 3.28e-64 195 68 0 144 3 rplO Large ribosomal subunit protein uL15 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1TYL6 8.5e-64 194 69 0 144 3 rplO Large ribosomal subunit protein uL15 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8K968 1.11e-63 194 65 0 143 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C5BQ80 7.04e-63 192 69 0 144 3 rplO Large ribosomal subunit protein uL15 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q1IFU7 5.83e-62 189 66 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas entomophila (strain L48)
B1JAJ3 8.65e-62 189 67 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain W619)
Q88QL6 8.65e-62 189 67 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK86 8.65e-62 189 67 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain GB-1)
A5VXR6 8.65e-62 189 67 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A5WCK9 9.69e-61 187 63 0 143 3 rplO Large ribosomal subunit protein uL15 Psychrobacter sp. (strain PRwf-1)
Q4ZMR3 1.07e-60 186 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas syringae pv. syringae (strain B728a)
Q889V2 1.07e-60 186 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48D55 1.07e-60 186 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4K552 1.27e-60 186 65 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B6J5F1 1.7e-60 186 64 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain CbuK_Q154)
B0V6W4 2.78e-60 185 65 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain AYE)
A3M965 2.78e-60 185 65 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQT7 2.78e-60 185 65 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain SDF)
B2HZ89 2.78e-60 185 65 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain ACICU)
B7IA20 2.78e-60 185 65 0 144 1 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain AB0057)
B7GW21 2.78e-60 185 65 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baumannii (strain AB307-0294)
Q83EQ7 3.11e-60 185 63 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAY9 3.11e-60 185 63 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KD12 3.11e-60 185 63 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain Dugway 5J108-111)
B6J244 3.11e-60 185 63 0 143 3 rplO Large ribosomal subunit protein uL15 Coxiella burnetii (strain CbuG_Q212)
Q1H4L8 3.03e-59 182 66 0 144 3 rplO Large ribosomal subunit protein uL15 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q6F7T1 3.2e-59 182 65 0 144 3 rplO Large ribosomal subunit protein uL15 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C1DKN2 2.54e-58 180 66 0 144 3 rplO Large ribosomal subunit protein uL15 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q3K607 6.16e-58 179 64 1 145 3 rplO Large ribosomal subunit protein uL15 Pseudomonas fluorescens (strain Pf0-1)
Q31IW3 6.72e-58 179 67 0 143 3 rplO Large ribosomal subunit protein uL15 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C3K2V7 1.3e-57 179 64 1 145 3 rplO Large ribosomal subunit protein uL15 Pseudomonas fluorescens (strain SBW25)
A4VHP9 5.27e-57 177 63 0 144 3 rplO Large ribosomal subunit protein uL15 Stutzerimonas stutzeri (strain A1501)
Q7VQC9 2.35e-56 176 61 0 142 3 rplO Large ribosomal subunit protein uL15 Blochmanniella floridana
Q9HWF4 6.46e-56 174 63 0 144 1 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T61 6.46e-56 174 63 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V663 6.46e-56 174 63 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain LESB58)
A6UZK7 6.46e-56 174 63 0 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas aeruginosa (strain PA7)
Q13TI9 7.21e-56 174 65 0 144 3 rplO Large ribosomal subunit protein uL15 Paraburkholderia xenovorans (strain LB400)
Q1QDG7 9.25e-56 174 64 0 144 3 rplO Large ribosomal subunit protein uL15 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B8GV39 1.77e-55 173 65 1 144 3 rplO Large ribosomal subunit protein uL15 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A1WVA3 1.86e-55 173 59 0 144 3 rplO Large ribosomal subunit protein uL15 Halorhodospira halophila (strain DSM 244 / SL1)
B2T732 4.15e-55 172 64 0 144 3 rplO Large ribosomal subunit protein uL15 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q0ABF6 8.1e-55 171 62 0 143 3 rplO Large ribosomal subunit protein uL15 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q63Q30 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain K96243)
A3NEG0 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain 668)
Q3JMT2 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain 1710b)
A3P094 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia pseudomallei (strain 1106a)
A1V884 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain SAVP1)
Q62GM4 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain ATCC 23344)
A2S7J5 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain NCTC 10229)
A3MRX3 9.86e-55 171 64 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia mallei (strain NCTC 10247)
A4XZ71 9.87e-55 171 63 1 144 3 rplO Large ribosomal subunit protein uL15 Pseudomonas mendocina (strain ymp)
B2JI46 1.23e-54 171 63 0 144 3 rplO Large ribosomal subunit protein uL15 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q4FUD7 3.07e-54 170 64 0 144 3 rplO Large ribosomal subunit protein uL15 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q1BRW7 5.09e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia orbicola (strain AU 1054)
B1JU41 5.09e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia orbicola (strain MC0-3)
Q39KE8 5.09e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0K3P4 5.09e-54 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia cenocepacia (strain HI2424)
A0Q4K2 5.88e-54 169 60 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. novicida (strain U112)
A4IZR5 6.01e-54 169 60 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHU9 6.01e-54 169 60 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14JA1 6.01e-54 169 60 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. tularensis (strain FSC 198)
Q2SU46 1e-53 169 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A1KRJ2 1.87e-53 168 60 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9K1I2 1.87e-53 168 60 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M3U7 1.87e-53 168 60 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup C (strain 053442)
B2SDW6 3.86e-53 167 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. mediasiatica (strain FSC147)
A4JAQ9 4.59e-53 167 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BJ27 4.59e-53 167 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4E5D9 4.59e-53 167 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B1YRP8 4.59e-53 167 63 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia ambifaria (strain MC40-6)
Q0BNQ8 7.28e-53 166 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A5F1 7.28e-53 166 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. holarctica (strain LVS)
A7N9U4 7.28e-53 166 59 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5F5U6 7.51e-53 166 60 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5CXM3 1.26e-52 166 56 0 144 3 rplO Large ribosomal subunit protein uL15 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4G9R9 1.93e-52 165 61 0 142 3 rplO Large ribosomal subunit protein uL15 Herminiimonas arsenicoxydans
Q9JX15 2.17e-52 165 60 0 143 3 rplO Large ribosomal subunit protein uL15 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9ADL2 2.29e-52 165 62 0 144 3 rplO Large ribosomal subunit protein uL15 Burkholderia multivorans (strain ATCC 17616 / 249)
Q2YAX8 8.63e-52 164 60 0 143 3 rplO Large ribosomal subunit protein uL15 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6T3I5 1.66e-51 163 60 0 142 3 rplO Large ribosomal subunit protein uL15 Janthinobacterium sp. (strain Marseille)
A5IHP6 2.49e-51 162 59 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila (strain Corby)
B0U0X0 2.78e-51 162 56 0 143 3 rplO Large ribosomal subunit protein uL15 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5WZJ3 7.69e-51 161 59 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila (strain Lens)
Q5ZYM4 7.69e-51 161 59 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5X840 7.69e-51 161 59 0 144 3 rplO Large ribosomal subunit protein uL15 Legionella pneumophila (strain Paris)
A9IHS7 9.54e-51 161 65 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7VTB2 1.17e-50 161 64 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WRA4 1.17e-50 161 64 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3J8T2 1.76e-50 160 58 0 144 3 rplO Large ribosomal subunit protein uL15 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q89A84 2.14e-50 160 57 1 145 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q2L260 1.62e-49 158 64 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella avium (strain 197N)
Q7W2D6 1.85e-49 158 63 0 128 3 rplO Large ribosomal subunit protein uL15 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q3SLN0 1.96e-49 158 60 0 144 3 rplO Large ribosomal subunit protein uL15 Thiobacillus denitrificans (strain ATCC 25259)
Q47J84 3.06e-49 157 60 0 144 3 rplO Large ribosomal subunit protein uL15 Dechloromonas aromatica (strain RCB)
Q057C3 5.4e-49 157 55 1 145 3 rplO Large ribosomal subunit protein uL15 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B2UEK0 2.53e-48 155 62 0 128 3 rplO Large ribosomal subunit protein uL15 Ralstonia pickettii (strain 12J)
Q5P313 7.21e-48 154 59 0 142 3 rplO Large ribosomal subunit protein uL15 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q1LI56 8.51e-48 154 62 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
C1DAT6 2.4e-47 152 64 0 128 3 rplO Large ribosomal subunit protein uL15 Laribacter hongkongensis (strain HLHK9)
B3R7E9 2.99e-47 152 62 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8XV31 3.34e-47 152 63 0 128 3 rplO Large ribosomal subunit protein uL15 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7NQH1 9.65e-47 151 62 0 128 3 rplO Large ribosomal subunit protein uL15 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q0K638 1.72e-46 150 61 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q46WG3 1.92e-46 150 61 0 128 3 rplO Large ribosomal subunit protein uL15 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8D1Z3 2.21e-46 150 54 1 144 3 rplO Large ribosomal subunit protein uL15 Wigglesworthia glossinidia brevipalpis
A5EX99 1.46e-45 148 59 0 144 3 rplO Large ribosomal subunit protein uL15 Dichelobacter nodosus (strain VCS1703A)
B5ELZ8 3.47e-45 147 55 2 146 3 rplO Large ribosomal subunit protein uL15 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J486 3.47e-45 147 55 2 146 3 rplO Large ribosomal subunit protein uL15 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q12G84 1.29e-44 145 56 0 142 3 rplO Large ribosomal subunit protein uL15 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VJ34 3.61e-43 142 54 0 142 3 rplO Large ribosomal subunit protein uL15 Polaromonas naphthalenivorans (strain CJ2)
A2SLD8 4.7e-43 142 57 0 128 3 rplO Large ribosomal subunit protein uL15 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
B8FER6 8.23e-43 141 52 1 144 3 rplO Large ribosomal subunit protein uL15 Desulfatibacillum aliphaticivorans
A1TJT6 9.25e-43 141 60 0 128 3 rplO Large ribosomal subunit protein uL15 Paracidovorax citrulli (strain AAC00-1)
A4SUY0 1.79e-42 140 59 0 128 3 rplO Large ribosomal subunit protein uL15 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q04BZ6 5.5e-42 139 50 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GBJ9 5.5e-42 139 50 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
A9BRX0 7.86e-42 139 58 0 128 3 rplO Large ribosomal subunit protein uL15 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1WK97 1.56e-41 138 58 0 128 3 rplO Large ribosomal subunit protein uL15 Verminephrobacter eiseniae (strain EF01-2)
A0PXW5 2.62e-41 137 54 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium novyi (strain NT)
A1W327 6.61e-41 136 57 0 128 3 rplO Large ribosomal subunit protein uL15 Acidovorax sp. (strain JS42)
B9MBV6 6.61e-41 136 57 0 128 3 rplO Large ribosomal subunit protein uL15 Acidovorax ebreus (strain TPSY)
B1XSS0 1.71e-40 135 56 0 144 3 rplO Large ribosomal subunit protein uL15 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q67JW2 1.78e-40 135 53 2 145 3 rplO Large ribosomal subunit protein uL15 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A1KB08 4.4e-40 134 58 0 123 3 rplO Large ribosomal subunit protein uL15 Azoarcus sp. (strain BH72)
B1Y8B8 1.63e-39 132 55 0 128 3 rplO Large ribosomal subunit protein uL15 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q6XYX0 2.33e-39 132 46 0 143 3 rplO Large ribosomal subunit protein uL15 Spiroplasma kunkelii
Q21QP2 6.54e-39 131 52 0 142 3 rplO Large ribosomal subunit protein uL15 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B9M6F9 1.07e-38 130 46 1 145 3 rplO Large ribosomal subunit protein uL15 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B8I7Z8 1.5e-38 130 50 2 145 3 rplO Large ribosomal subunit protein uL15 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A5GAW1 2.32e-38 130 45 1 145 3 rplO Large ribosomal subunit protein uL15 Geotalea uraniireducens (strain Rf4)
A3DJJ1 3.05e-38 129 50 1 144 3 rplO Large ribosomal subunit protein uL15 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
C6E4N8 8.14e-38 128 48 3 147 3 rplO Large ribosomal subunit protein uL15 Geobacter sp. (strain M21)
B5EFR9 8.14e-38 128 48 3 147 3 rplO Large ribosomal subunit protein uL15 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
C5CQ81 1.45e-37 128 53 0 128 3 rplO Large ribosomal subunit protein uL15 Variovorax paradoxus (strain S110)
Q6F1X6 2.35e-37 127 48 2 145 3 rplO Large ribosomal subunit protein uL15 Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
Q0AIH7 2.73e-37 127 48 1 144 3 rplO Large ribosomal subunit protein uL15 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A6LPT0 4.27e-37 127 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q9PE57 6.39e-37 126 48 1 145 3 rplO Large ribosomal subunit protein uL15 Xylella fastidiosa (strain 9a5c)
Q87E63 6.8e-37 126 48 1 145 3 rplO Large ribosomal subunit protein uL15 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q0SQG3 9.05e-37 126 48 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridium perfringens (strain SM101 / Type A)
Q8XHU2 9.05e-37 126 48 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridium perfringens (strain 13 / Type A)
Q0TMR5 9.05e-37 126 48 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B8G1Y5 1.02e-36 125 46 1 145 3 rplO Large ribosomal subunit protein uL15 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q2IJ68 1.12e-36 126 53 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q250L3 1.13e-36 125 46 1 145 3 rplO Large ribosomal subunit protein uL15 Desulfitobacterium hafniense (strain Y51)
A8ZV76 1.35e-36 125 51 1 144 3 rplO Large ribosomal subunit protein uL15 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
B0K5R1 2.38e-36 125 48 1 145 3 rplO Large ribosomal subunit protein uL15 Thermoanaerobacter sp. (strain X514)
B0KCL8 2.38e-36 125 48 1 145 3 rplO Large ribosomal subunit protein uL15 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B2UYC9 4.54e-36 124 46 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Alaska E43 / Type E3)
B4UBB8 4.83e-36 124 53 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter sp. (strain K)
B8J879 4.83e-36 124 53 1 143 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A9VP96 5.01e-36 124 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus mycoides (strain KBAB4)
P10138 5.25e-36 124 46 0 143 3 rplO Large ribosomal subunit protein uL15 Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
B2TIJ4 7.66e-36 123 46 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Eklund 17B / Type B)
C0ZIJ9 8.01e-36 123 49 3 146 3 rplO Large ribosomal subunit protein uL15 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q3A6M8 1.05e-35 123 48 1 145 3 rplO Large ribosomal subunit protein uL15 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q6HPN9 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H71 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain ZK / E33L)
B9IZL3 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain Q1)
B7HQW3 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain AH187)
C1ET58 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain 03BB102)
Q73F77 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKD8 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain AH820)
Q81VR1 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus anthracis
A0R8J9 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus thuringiensis (strain Al Hakam)
C3LJA1 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9S4 1.17e-35 123 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus anthracis (strain A0248)
A5D5H4 1.32e-35 123 47 1 144 3 rplO Large ribosomal subunit protein uL15 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q839E5 1.44e-35 123 48 3 146 1 rplO Large ribosomal subunit protein uL15 Enterococcus faecalis (strain ATCC 700802 / V583)
B7IT38 1.46e-35 123 47 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain G9842)
Q81J23 1.54e-35 122 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HJ67 1.54e-35 122 48 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cereus (strain B4264)
Q2RFR6 1.79e-35 122 50 1 144 3 rplO Large ribosomal subunit protein uL15 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A8MLF9 1.83e-35 122 50 2 145 3 rplO Large ribosomal subunit protein uL15 Alkaliphilus oremlandii (strain OhILAs)
Q605D1 6.67e-35 121 56 0 143 3 rplO Large ribosomal subunit protein uL15 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5N4R6 7e-35 121 45 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYC8 7e-35 121 45 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium kluyveri (strain NBRC 12016)
B1I1L8 7.55e-35 121 47 1 144 3 rplO Large ribosomal subunit protein uL15 Desulforudis audaxviator (strain MP104C)
A7GK39 7.89e-35 121 47 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q6MSP3 8.45e-35 120 45 0 143 3 rplO Large ribosomal subunit protein uL15 Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q82X73 8.85e-35 121 47 1 144 3 rplO Large ribosomal subunit protein uL15 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B3E849 1.67e-34 120 45 2 145 3 rplO Large ribosomal subunit protein uL15 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q8PNQ9 1.76e-34 120 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas axonopodis pv. citri (strain 306)
B3E0K2 1.78e-34 120 49 1 144 3 rplO Large ribosomal subunit protein uL15 Methylacidiphilum infernorum (isolate V4)
Q3BWW4 1.88e-34 120 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2P004 2.14e-34 120 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PC34 2.66e-34 119 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URF8 2.66e-34 119 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas campestris pv. campestris (strain 8004)
C0ME24 2.76e-34 119 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U519 2.76e-34 119 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0MBW6 2.76e-34 119 46 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus equi subsp. equi (strain 4047)
C1FMT2 2.91e-34 119 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Kyoto / Type A2)
A5I7I7 2.91e-34 119 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVN2 2.91e-34 119 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain 657 / Type Ba4)
A7FQ41 2.91e-34 119 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain ATCC 19397 / Type A)
P35138 2.98e-34 119 47 3 146 3 rplO Large ribosomal subunit protein uL15 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A4XLR2 3.65e-34 119 48 1 145 3 rplO Large ribosomal subunit protein uL15 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q5GWV4 3.7e-34 119 50 1 126 3 rplO Large ribosomal subunit protein uL15 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B1IGD5 4.5e-34 119 50 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Okra / Type B1)
Q1AU48 4.96e-34 119 46 2 150 3 rplO Large ribosomal subunit protein uL15 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
P38373 6.45e-34 119 48 3 146 3 rplO Large ribosomal subunit protein uL15 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A9NEF2 7.35e-34 118 43 1 144 3 rplO Large ribosomal subunit protein uL15 Acholeplasma laidlawii (strain PG-8A)
A7GJ55 8.66e-34 118 49 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q39XY7 8.97e-34 118 45 2 146 3 rplO Large ribosomal subunit protein uL15 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B1KSK6 1.28e-33 118 49 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium botulinum (strain Loch Maree / Type A3)
Q03ED5 1.5e-33 117 45 3 145 3 rplO Large ribosomal subunit protein uL15 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q8R7X2 1.64e-33 117 44 1 145 3 rplO Large ribosomal subunit protein uL15 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A4IJK7 1.85e-33 117 45 2 145 3 rplO Large ribosomal subunit protein uL15 Geobacillus thermodenitrificans (strain NG80-2)
Q5WLP3 2.18e-33 117 46 3 154 3 rplO Large ribosomal subunit protein uL15 Shouchella clausii (strain KSM-K16)
B2A4F8 2.74e-33 117 45 3 146 3 rplO Large ribosomal subunit protein uL15 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q8E2B5 3.13e-33 117 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7S2 3.13e-33 117 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3V0 3.13e-33 117 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B9DSW9 3.16e-33 117 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B0RZS8 3.64e-33 117 48 3 147 3 rplO Large ribosomal subunit protein uL15 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q890Q3 3.8e-33 117 48 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium tetani (strain Massachusetts / E88)
A7HBN7 3.97e-33 117 52 3 145 3 rplO Large ribosomal subunit protein uL15 Anaeromyxobacter sp. (strain Fw109-5)
B9MKG3 4.61e-33 116 46 1 145 3 rplO Large ribosomal subunit protein uL15 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B9E9L0 5.63e-33 116 45 1 144 3 rplO Large ribosomal subunit protein uL15 Macrococcus caseolyticus (strain JCSC5402)
P19946 6.35e-33 116 44 1 144 1 rplO Large ribosomal subunit protein uL15 Bacillus subtilis (strain 168)
Q3A9T5 8.89e-33 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B1HMW1 1.12e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Lysinibacillus sphaericus (strain C3-41)
A7Z0Q7 1.82e-32 115 43 2 145 3 rplO Large ribosomal subunit protein uL15 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B5XJ55 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE07 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT0 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC33 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Z4 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ43 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JNZ8 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE40 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M12 (strain MGAS2096)
Q7CNP1 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEB6 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE06 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q9A1V5 1.99e-32 115 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pyogenes serotype M1
B1YGW9 2.27e-32 114 45 3 146 3 rplO Large ribosomal subunit protein uL15 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C1CPA7 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIB6 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain P1031)
C1CC25 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain JJA)
Q8CWV0 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IS59 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain CGSP14)
Q97SU3 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKP9 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I8L7 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAN1 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae (strain 70585)
B5E6H4 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae serotype 19F (strain G54)
Q04ML7 2.7e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
A8F9A4 3.32e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Bacillus pumilus (strain SAFR-032)
C4KZM7 3.66e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q97EJ7 3.91e-32 114 45 1 144 3 rplO Large ribosomal subunit protein uL15 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q03IH0 5.13e-32 114 44 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
A6TWG3 5.51e-32 114 49 3 146 3 rplO Large ribosomal subunit protein uL15 Alkaliphilus metalliredigens (strain QYMF)
Q5M2D2 5.78e-32 114 44 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXT0 5.78e-32 114 44 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus thermophilus (strain CNRZ 1066)
C5D3T6 8.01e-32 113 45 1 144 3 rplO Large ribosomal subunit protein uL15 Geobacillus sp. (strain WCH70)
P04452 1.02e-31 113 45 1 144 1 rplO Large ribosomal subunit protein uL15 Geobacillus stearothermophilus
Q5L3S0 1.02e-31 113 45 1 144 3 rplO Large ribosomal subunit protein uL15 Geobacillus kaustophilus (strain HTA426)
Q8ETW5 1.31e-31 112 46 1 144 3 rplO Large ribosomal subunit protein uL15 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q6AP51 1.9e-31 112 48 4 145 3 rplO Large ribosomal subunit protein uL15 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q1D756 2.11e-31 113 47 1 144 3 rplO Large ribosomal subunit protein uL15 Myxococcus xanthus (strain DK1622)
B7GJ86 2.15e-31 112 45 1 144 3 rplO Large ribosomal subunit protein uL15 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B0TC75 3.17e-31 112 48 3 147 3 rplO Large ribosomal subunit protein uL15 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q0AUJ9 3.36e-31 112 45 1 144 3 rplO Large ribosomal subunit protein uL15 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q18CH7 3.5e-31 112 46 2 145 3 rplO Large ribosomal subunit protein uL15 Clostridioides difficile (strain 630)
Q8DS31 5.09e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A1ALW0 5.12e-31 111 43 2 146 3 rplO Large ribosomal subunit protein uL15 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
P0A0F7 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain MW2)
A8Z338 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G790 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain MSSA476)
Q6GEK2 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain MRSA252)
P0A0F6 5.2e-31 111 43 1 144 1 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain N315)
P0A0F5 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ73 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain Newman)
Q5HDX7 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain COL)
Q2YYL6 5.2e-31 111 43 1 144 1 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV15 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain JH9)
P0A0F8 5.2e-31 111 43 1 144 1 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEQ8 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain USA300)
A6U3V6 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain JH1)
A7X5D4 5.2e-31 111 43 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q046A7 5.43e-31 111 45 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
C0Q9V4 1.05e-30 110 50 1 144 3 rplO Large ribosomal subunit protein uL15 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
B2UQM8 1.17e-30 110 42 2 147 3 rplO Large ribosomal subunit protein uL15 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A3CK83 1.38e-30 110 44 1 144 3 rplO Large ribosomal subunit protein uL15 Streptococcus sanguinis (strain SK36)
A8AZK6 1.59e-30 110 44 3 146 3 rplO Large ribosomal subunit protein uL15 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A4J130 2.18e-30 109 48 3 145 3 rplO Large ribosomal subunit protein uL15 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q749A6 2.36e-30 109 46 3 147 3 rplO Large ribosomal subunit protein uL15 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q74L71 3.23e-30 109 44 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q8RIH5 3.61e-30 109 39 2 146 3 rplO Large ribosomal subunit protein uL15 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A5V5Y3 3.69e-30 110 47 2 150 3 rplO Large ribosomal subunit protein uL15 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
C4ZBT7 6.33e-30 108 45 3 145 3 rplO Large ribosomal subunit protein uL15 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q04G67 7.66e-30 108 40 3 145 3 rplO Large ribosomal subunit protein uL15 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
B1MVZ6 1.15e-29 107 46 4 146 3 rplO Large ribosomal subunit protein uL15 Leuconostoc citreum (strain KM20)
Q03ZM7 1.28e-29 107 47 4 146 3 rplO Large ribosomal subunit protein uL15 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q6MJ31 2.12e-29 107 49 3 142 3 rplO Large ribosomal subunit protein uL15 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B5YG29 2.19e-29 107 42 3 148 3 rplO Large ribosomal subunit protein uL15 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
A0ALU9 2.84e-29 107 44 2 145 3 rplO Large ribosomal subunit protein uL15 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y447 3.03e-29 107 44 2 145 1 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB27 3.03e-29 107 44 2 145 3 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WG5 3.03e-29 107 44 2 145 3 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serotype 4b (strain F2365)
C1KZG1 3.03e-29 107 44 2 145 3 rplO Large ribosomal subunit protein uL15 Listeria monocytogenes serotype 4b (strain CLIP80459)
B5Y969 3.51e-29 107 43 3 149 3 rplO Large ribosomal subunit protein uL15 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q927M6 4.28e-29 106 44 2 145 3 rplO Large ribosomal subunit protein uL15 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1ISA3 4.82e-29 106 46 1 143 3 rplO Large ribosomal subunit protein uL15 Koribacter versatilis (strain Ellin345)
Q73PL3 5.69e-29 106 40 2 145 3 rplO Large ribosomal subunit protein uL15 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A8F4T0 5.81e-29 106 43 1 144 3 rplO Large ribosomal subunit protein uL15 Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO)
Q7UN02 6.36e-29 106 43 2 136 3 rplO Large ribosomal subunit protein uL15 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A9IW02 6.82e-29 106 44 3 149 3 rplO Large ribosomal subunit protein uL15 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A6X0D7 1.19e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q1MIC2 1.22e-28 105 45 3 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q49ZE9 1.23e-28 105 42 1 144 3 rplO Large ribosomal subunit protein uL15 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q11HS1 1.54e-28 105 48 3 150 3 rplO Large ribosomal subunit protein uL15 Chelativorans sp. (strain BNC1)
B3PWU0 1.71e-28 105 45 3 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium etli (strain CIAT 652)
B5ZYV4 1.76e-28 105 45 3 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q38UT0 1.85e-28 104 47 2 144 3 rplO Large ribosomal subunit protein uL15 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8G090 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella suis biovar 1 (strain 1330)
B0CH13 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VQY7 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YHM1 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJI2 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5N1 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CS7 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella abortus biovar 1 (strain 9-941)
Q2YRT5 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella abortus (strain 2308)
B2S660 2.05e-28 105 47 3 150 3 rplO Large ribosomal subunit protein uL15 Brucella abortus (strain S19)
Q1IX91 2.12e-28 105 46 2 142 3 rplO Large ribosomal subunit protein uL15 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B3QYE3 2.9e-28 105 43 4 146 3 rplO Large ribosomal subunit protein uL15 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q1WSA9 3.16e-28 104 42 2 144 3 rplO Large ribosomal subunit protein uL15 Ligilactobacillus salivarius (strain UCC118)
O52350 3.62e-28 104 41 3 147 3 rplO Large ribosomal subunit protein uL15 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q3ZZQ5 9.83e-28 103 43 3 146 3 rplO Large ribosomal subunit protein uL15 Dehalococcoides mccartyi (strain CBDB1)
A5FRW3 9.83e-28 103 43 3 146 3 rplO Large ribosomal subunit protein uL15 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
A6LLN2 1.05e-27 103 40 1 145 3 rplO Large ribosomal subunit protein uL15 Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q3Z962 1.11e-27 103 42 3 146 3 rplO Large ribosomal subunit protein uL15 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q6G2Y4 1.21e-27 103 42 3 153 3 rplO Large ribosomal subunit protein uL15 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q0ANR9 1.23e-27 103 48 3 149 3 rplO Large ribosomal subunit protein uL15 Maricaulis maris (strain MCS10)
A7HM33 1.57e-27 102 37 1 145 3 rplO Large ribosomal subunit protein uL15 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
P35139 1.72e-27 102 44 3 146 3 rplO Large ribosomal subunit protein uL15 Staphylococcus carnosus (strain TM300)
B7IHW5 2.64e-27 102 40 1 145 3 rplO Large ribosomal subunit protein uL15 Thermosipho africanus (strain TCF52B)
Q0BYD3 2.78e-27 102 45 3 148 3 rplO Large ribosomal subunit protein uL15 Hyphomonas neptunium (strain ATCC 15444)
Q2K9J7 3.08e-27 102 44 3 149 3 rplO Large ribosomal subunit protein uL15 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2LQB8 6.48e-27 100 47 2 146 3 rplO Large ribosomal subunit protein uL15 Syntrophus aciditrophicus (strain SB)
B1LBM1 8.14e-27 100 40 1 145 3 rplO Large ribosomal subunit protein uL15 Thermotoga sp. (strain RQ2)
A5IMA2 8.14e-27 100 40 1 145 3 rplO Large ribosomal subunit protein uL15 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B2ITN8 9.27e-27 100 42 2 145 3 rplO Large ribosomal subunit protein uL15 Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q6FZE1 9.42e-27 100 44 3 149 3 rplO Large ribosomal subunit protein uL15 Bartonella quintana (strain Toulouse)
Q8KAJ0 1e-26 101 44 4 150 3 rplO Large ribosomal subunit protein uL15 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B8H4F3 1.01e-26 100 43 2 148 3 rplO Large ribosomal subunit protein uL15 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8T4 1.01e-26 100 43 2 148 3 rplO Large ribosomal subunit protein uL15 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B9JVQ6 1.1e-26 100 46 3 151 3 rplO Large ribosomal subunit protein uL15 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A8LM76 1.29e-26 100 43 4 150 3 rplO Large ribosomal subunit protein uL15 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A9W4S1 1.32e-26 100 44 3 149 3 rplO Large ribosomal subunit protein uL15 Methylorubrum extorquens (strain PA1)
B7L0T1 1.32e-26 100 44 3 149 3 rplO Large ribosomal subunit protein uL15 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A8YXM4 1.57e-26 100 43 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus helveticus (strain DPC 4571)
B8ISA4 1.89e-26 100 43 3 151 3 rplO Large ribosomal subunit protein uL15 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
O67561 1.96e-26 99 43 3 146 3 rplO Large ribosomal subunit protein uL15 Aquifex aeolicus (strain VF5)
Q9X1J0 2.23e-26 99 40 1 145 3 rplO Large ribosomal subunit protein uL15 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A4WVI9 2.23e-26 100 44 3 149 3 rplO Large ribosomal subunit protein uL15 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q03PX6 2.4e-26 99 46 4 132 3 rplO Large ribosomal subunit protein uL15 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q5FM72 2.7e-26 99 43 1 144 3 rplO Large ribosomal subunit protein uL15 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B9KLB0 2.81e-26 99 47 5 151 3 rplO Large ribosomal subunit protein uL15 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5Q3 2.81e-26 99 47 5 151 3 rplO Large ribosomal subunit protein uL15 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGN0 2.81e-26 99 47 5 151 3 rplO Large ribosomal subunit protein uL15 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B4R8N6 3.21e-26 99 44 3 148 3 rplO Large ribosomal subunit protein uL15 Phenylobacterium zucineum (strain HLK1)
Q50300 3.29e-26 99 42 4 148 1 rplO Large ribosomal subunit protein uL15 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q2NIX3 3.68e-26 99 38 1 142 3 rplO Large ribosomal subunit protein uL15 Aster yellows witches'-broom phytoplasma (strain AYWB)
A0L5Z2 4.59e-26 99 42 2 145 3 rplO Large ribosomal subunit protein uL15 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B3QR90 4.65e-26 99 44 4 149 3 rplO Large ribosomal subunit protein uL15 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B0UHV0 4.96e-26 99 43 3 151 3 rplO Large ribosomal subunit protein uL15 Methylobacterium sp. (strain 4-46)
A9H3K5 5.35e-26 99 44 4 150 3 rplO Large ribosomal subunit protein uL15 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS16245
Feature type CDS
Gene rplO
Product 50S ribosomal protein L15
Location 3591137 - 3591571 (strand: 1)
Length 435 (nucleotides) / 144 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2413
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00828 Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0200 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L15

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02876 large subunit ribosomal protein L15 Ribosome -

Protein Sequence

MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTGGRGHKGQKSRSGGGVRRGFEGGQMPLYRRLPKFGFTSRKSFVTAEIRLSDLAYVEGDVIDLNALKAANVVGPQIEFAKLILSGEVNRAVTIRGLRVTKGARAAIESAGGKIEE

Flanking regions ( +/- flanking 50bp)

GCGGTATGATCAACTTGGTTTCCTATATGGTTAAAGTTGAGGAGTAAGAGATGCGTTTAAATACTCTGTCTCCGGCTGAAGGTGCCAAGCATGCGCCTAAACGTGTAGGTCGTGGTATCGGTTCTGGCCTAGGTAAAACTGGCGGCCGTGGTCACAAAGGTCAGAAATCTCGTTCTGGCGGTGGCGTACGTCGTGGTTTTGAAGGTGGTCAGATGCCTTTATACCGTCGTTTACCAAAATTTGGTTTTACTTCACGTAAATCATTCGTGACTGCGGAAATCCGTCTGTCTGATTTGGCTTATGTTGAAGGCGATGTAATCGATCTGAATGCACTGAAAGCCGCAAACGTTGTTGGCCCACAGATTGAATTTGCAAAATTAATTCTGTCTGGCGAGGTTAACCGTGCAGTGACTATTCGTGGTCTGCGTGTTACCAAAGGTGCCCGTGCAGCAATCGAATCAGCTGGCGGTAAAATTGAGGAATAAGTGACAGATGGCTAAACAACCAGGGTTAGATTTTCAGAGTGCTAAAGGTG