Homologs in group_3058

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18275 FBDBKF_18275 100.0 Morganella morganii S1 - Putative Se/S carrier protein-like domain-containing protein
EHELCC_18310 EHELCC_18310 100.0 Morganella morganii S2 - Putative Se/S carrier protein-like domain-containing protein
NLDBIP_18235 NLDBIP_18235 100.0 Morganella morganii S4 - Putative Se/S carrier protein-like domain-containing protein
HKOGLL_18165 HKOGLL_18165 100.0 Morganella morganii S5 - Putative Se/S carrier protein-like domain-containing protein
F4V73_RS01800 F4V73_RS01800 72.5 Morganella psychrotolerans - putative Se/S carrier-like protein

Distribution of the homologs in the orthogroup group_3058

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3058

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DN74 4.65e-08 48 47 0 48 4 ytiA Uncharacterized protein YtiA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18430
Feature type CDS
Gene -
Product Putative Se/S carrier protein-like domain-containing protein
Location 18452 - 18694 (strand: 1)
Length 243 (nucleotides) / 80 (amino acids)

Contig

Accession ZDB_383
Length 35029 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3058
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF11823 Putative Se/S carrier protein-like

Protein Sequence

MNDYLILFENMLGVVAMRKHLTAAGQPFTVTDIPPSLGKACGLGIRLSVSDDSLPALRDRPQVTEIYRCEAAEYVLTAAE

Flanking regions ( +/- flanking 50bp)

ATCCGTCAGTTACAGAAACAGGCCGTCATGACCTCCGGGGATATCCGTTCATGAATGACTATCTGATTTTATTTGAAAATATGCTCGGTGTGGTGGCGATGCGTAAGCATCTTACAGCGGCCGGGCAGCCTTTCACCGTGACGGACATCCCGCCGTCACTGGGCAAAGCCTGTGGTCTGGGGATCCGCCTCAGTGTCAGTGATGATTCACTCCCGGCACTGCGCGACCGTCCGCAGGTCACGGAAATATACCGCTGTGAAGCGGCGGAATATGTGCTGACGGCAGCGGAGTAAACCGCGCTTACAGACAGATAACAAACCACAATCACGATAATCCGGCATTT