Homologs in group_3061

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18275 FBDBKF_18275 100.0 Morganella morganii S1 - Putative Se/S carrier protein-like domain-containing protein
EHELCC_18310 EHELCC_18310 100.0 Morganella morganii S2 - Putative Se/S carrier protein-like domain-containing protein
NLDBIP_18235 NLDBIP_18235 100.0 Morganella morganii S4 - Putative Se/S carrier protein-like domain-containing protein
LHKJJB_18430 LHKJJB_18430 100.0 Morganella morganii S3 - Putative Se/S carrier protein-like domain-containing protein
F4V73_RS01800 F4V73_RS01800 72.5 Morganella psychrotolerans - putative Se/S carrier-like protein

Distribution of the homologs in the orthogroup group_3061

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3061

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0DN74 4.65e-08 48 47 0 48 4 ytiA Uncharacterized protein YtiA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_18165
Feature type CDS
Gene -
Product Putative Se/S carrier protein-like domain-containing protein
Location 18430 - 18672 (strand: 1)
Length 243 (nucleotides) / 80 (amino acids)
In genomic island -

Contig

Accession ZDB_704
Length 35007 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3061
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF11823 Putative Se/S carrier protein-like

Protein Sequence

MNDYLILFENMLGVVAMRKHLTAAGQPFTVTDIPPSLGKACGLGIRLSVSDDSLPALRDRPQVTEIYRCEAAEYVLTAAE

Flanking regions ( +/- flanking 50bp)

ATCCGTCAGTTACAGAAACAGGCCGTCATGACCTCCGGGGATATCCGTTCATGAATGACTATCTGATTTTATTTGAAAATATGCTCGGTGTGGTGGCGATGCGTAAGCATCTTACAGCGGCCGGGCAGCCTTTCACCGTGACGGACATCCCGCCGTCACTGGGCAAAGCCTGTGGTCTGGGGATCCGCCTCAGTGTCAGTGATGATTCACTCCCGGCACTGCGCGACCGTCCGCAGGTCACGGAAATATACCGCTGTGAAGCGGCGGAATATGTGCTGACGGCAGCGGAGTAAACCGCGCTTACAGACAGATAACAAACCACAATCACGATAATCCGGCATTT