Homologs in group_2327

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17615 FBDBKF_17615 100.0 Morganella morganii S1 thiG Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)
EHELCC_18100 EHELCC_18100 100.0 Morganella morganii S2 thiG Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)
NLDBIP_18050 NLDBIP_18050 100.0 Morganella morganii S4 thiG Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)
HKOGLL_17955 HKOGLL_17955 100.0 Morganella morganii S5 thiG Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)
F4V73_RS14995 F4V73_RS14995 88.6 Morganella psychrotolerans - thiazole synthase
PMI_RS13735 PMI_RS13735 76.1 Proteus mirabilis HI4320 - thiazole synthase

Distribution of the homologs in the orthogroup group_2327

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2327

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A8G8F0 6.29e-142 401 77 0 252 3 thiG Thiazole synthase Serratia proteamaculans (strain 568)
B4EYU5 1.72e-141 400 74 1 259 3 thiG Thiazole synthase Proteus mirabilis (strain HI4320)
A1JII4 2.68e-139 394 75 1 256 3 thiG Thiazole synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A9N0K2 3.18e-138 391 74 0 255 3 thiG Thiazole synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RFJ4 7.23e-138 390 74 0 255 3 thiG Thiazole synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QYE5 7.23e-138 390 74 0 255 3 thiG Thiazole synthase Salmonella enteritidis PT4 (strain P125109)
C6DHS2 3.08e-137 389 75 0 252 3 thiG Thiazole synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5BJQ9 4.55e-137 389 74 0 255 3 thiG Thiazole synthase Salmonella paratyphi A (strain AKU_12601)
Q5PK87 4.55e-137 389 74 0 255 3 thiG Thiazole synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5XYE8 6.12e-137 388 74 0 255 3 thiG Thiazole synthase Klebsiella pneumoniae (strain 342)
B5F1H3 8.23e-137 388 74 0 255 3 thiG Thiazole synthase Salmonella agona (strain SL483)
C0Q2S2 1.09e-136 387 74 0 255 3 thiG Thiazole synthase Salmonella paratyphi C (strain RKS4594)
Q57H64 1.09e-136 387 74 0 255 3 thiG Thiazole synthase Salmonella choleraesuis (strain SC-B67)
A6TGP7 1.7e-136 387 74 0 255 3 thiG Thiazole synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q8Z322 2.35e-135 384 74 0 255 3 thiG Thiazole synthase Salmonella typhi
Q9L9J1 2.96e-135 384 73 0 255 3 thiG Thiazole synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TQK0 3.34e-135 384 73 0 255 3 thiG Thiazole synthase Salmonella schwarzengrund (strain CVM19633)
Q6DAM4 5.59e-135 384 74 0 252 3 thiG Thiazole synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JJK2 5.73e-135 384 71 1 265 3 thiG Thiazole synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FP9 6.06e-135 384 71 1 265 3 thiG Thiazole synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CN74 6.06e-135 384 71 1 265 3 thiG Thiazole synthase Yersinia pestis bv. Antiqua (strain Nepal516)
B2K116 6.06e-135 384 71 1 265 3 thiG Thiazole synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1U5 6.06e-135 384 71 1 265 3 thiG Thiazole synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNH9 6.06e-135 384 71 1 265 3 thiG Thiazole synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8AKT3 6.73e-135 383 73 0 254 3 thiG Thiazole synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8ZAP9 1.06e-134 383 70 1 265 3 thiG Thiazole synthase Yersinia pestis
Q3YUZ4 1.56e-134 382 73 0 254 3 thiG Thiazole synthase Shigella sonnei (strain Ss046)
Q31U06 1.56e-134 382 73 0 254 3 thiG Thiazole synthase Shigella boydii serotype 4 (strain Sb227)
B2TWH8 1.56e-134 382 73 0 254 3 thiG Thiazole synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8A790 1.56e-134 382 73 0 254 3 thiG Thiazole synthase Escherichia coli O9:H4 (strain HS)
Q7N966 2.1e-134 382 76 0 255 3 thiG Thiazole synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B6I5K1 2.32e-134 382 73 0 254 3 thiG Thiazole synthase Escherichia coli (strain SE11)
B7LA84 2.32e-134 382 73 0 254 3 thiG Thiazole synthase Escherichia coli (strain 55989 / EAEC)
A7ZUK5 2.32e-134 382 73 0 254 3 thiG Thiazole synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UPE5 5.39e-134 381 72 0 254 3 thiG Thiazole synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P30139 5.95e-134 380 73 0 254 1 thiG Thiazole synthase Escherichia coli (strain K12)
B1IUQ7 5.95e-134 380 73 0 254 3 thiG Thiazole synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XBZ3 5.95e-134 380 73 0 254 3 thiG Thiazole synthase Escherichia coli (strain K12 / DH10B)
C5A0T1 5.95e-134 380 73 0 254 3 thiG Thiazole synthase Escherichia coli (strain K12 / MC4100 / BW2952)
Q8FB81 9.22e-134 380 72 0 254 3 thiG Thiazole synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA75 9.22e-134 380 73 0 254 3 thiG Thiazole synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7N2J2 9.22e-134 380 73 0 254 3 thiG Thiazole synthase Escherichia coli O81 (strain ED1a)
B7LUL2 1.02e-133 380 72 0 254 3 thiG Thiazole synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7NFT1 1.34e-133 380 72 0 254 3 thiG Thiazole synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7M738 2.01e-133 379 72 0 254 3 thiG Thiazole synthase Escherichia coli O8 (strain IAI1)
Q83PC0 2.37e-133 379 72 0 254 3 thiG Thiazole synthase Shigella flexneri
B7MIX6 1.29e-132 377 72 0 254 3 thiG Thiazole synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NRS3 1.4e-132 377 72 0 254 3 thiG Thiazole synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A4W5B3 1.52e-132 377 72 0 254 3 thiG Thiazole synthase Enterobacter sp. (strain 638)
P58263 1.61e-132 377 72 0 254 3 thiG Thiazole synthase Escherichia coli O157:H7
A9MHE0 1.81e-132 377 72 0 252 3 thiG Thiazole synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q32AG3 2.97e-132 376 72 0 254 3 thiG Thiazole synthase Shigella dysenteriae serotype 1 (strain Sd197)
A7MQQ2 6.31e-131 373 72 0 254 3 thiG Thiazole synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q7MGM7 1.39e-130 372 70 0 252 3 thiG Thiazole synthase Vibrio vulnificus (strain YJ016)
Q8DDL8 1.39e-130 372 70 0 252 3 thiG Thiazole synthase Vibrio vulnificus (strain CMCP6)
A7N137 3.88e-130 371 69 0 255 3 thiG Thiazole synthase Vibrio campbellii (strain ATCC BAA-1116)
Q87KF4 1.02e-129 370 69 0 255 3 thiG Thiazole synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A4SSI2 1.66e-128 367 72 0 255 3 thiG Thiazole synthase Aeromonas salmonicida (strain A449)
Q5E8W6 1.59e-127 364 69 0 252 3 thiG Thiazole synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FF70 2.41e-127 364 69 0 252 3 thiG Thiazole synthase Aliivibrio fischeri (strain MJ11)
Q1LU41 4.38e-127 363 69 0 252 3 thiG Thiazole synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q6LVX7 1.52e-126 362 70 0 252 3 thiG Thiazole synthase Photobacterium profundum (strain SS9)
B7VMV3 1.76e-126 362 68 0 252 3 thiG Thiazole synthase Vibrio atlanticus (strain LGP32)
Q5R146 2.92e-126 361 67 1 256 3 thiG Thiazole synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1S6Q5 9.45e-124 355 68 0 252 3 thiG Thiazole synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B6EGV5 1.19e-122 352 69 0 251 3 thiG Thiazole synthase Aliivibrio salmonicida (strain LFI1238)
A6WNR8 2e-122 351 68 0 252 3 thiG Thiazole synthase Shewanella baltica (strain OS185)
B8EA59 2e-122 351 68 0 252 3 thiG Thiazole synthase Shewanella baltica (strain OS223)
A9L3J3 5.02e-122 350 68 0 252 3 thiG Thiazole synthase Shewanella baltica (strain OS195)
A3D465 5.02e-122 350 68 0 252 3 thiG Thiazole synthase Shewanella baltica (strain OS155 / ATCC BAA-1091)
A8FUV3 5.66e-122 350 67 0 253 3 thiG Thiazole synthase Shewanella sediminis (strain HAW-EB3)
A4Y6R6 1.95e-121 349 68 0 252 3 thiG Thiazole synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RJR5 2.86e-121 348 68 0 252 3 thiG Thiazole synthase Shewanella sp. (strain W3-18-1)
A0KWK2 1.07e-120 347 66 0 252 3 thiG Thiazole synthase Shewanella sp. (strain ANA-3)
Q0HJ08 1.45e-120 347 67 0 252 3 thiG Thiazole synthase Shewanella sp. (strain MR-4)
C3LPQ7 2.86e-120 346 69 0 252 3 thiG Thiazole synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KVS4 2.86e-120 346 69 0 252 3 thiG Thiazole synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E2 2.86e-120 346 69 0 252 3 thiG Thiazole synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q11YI1 4.08e-120 346 67 0 254 3 thiG Thiazole synthase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q0HUX4 4.77e-120 345 67 0 252 3 thiG Thiazole synthase Shewanella sp. (strain MR-7)
Q8EEE1 6.13e-120 345 67 0 252 3 thiG Thiazole synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B4S2W0 3.43e-119 343 64 0 252 3 thiG Thiazole synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8H562 5.16e-118 340 64 0 252 3 thiG Thiazole synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CNW1 2.05e-117 339 64 0 252 3 thiG Thiazole synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QER0 2.46e-117 338 64 1 255 3 thiG Thiazole synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A6VXY2 2.52e-117 338 65 0 254 3 thiG Thiazole synthase Marinomonas sp. (strain MWYL1)
Q081M2 6.94e-117 338 63 0 252 3 thiG Thiazole synthase Shewanella frigidimarina (strain NCIMB 400)
B1KHI0 7.72e-117 337 65 0 252 3 thiG Thiazole synthase Shewanella woodyi (strain ATCC 51908 / MS32)
B0TS89 8.9e-117 337 64 0 252 3 thiG Thiazole synthase Shewanella halifaxensis (strain HAW-EB4)
A6L646 3.22e-116 336 67 1 253 3 thiG Thiazole synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6GWS0 3.91e-116 335 66 0 251 3 thiG Thiazole synthase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q8AA14 2.54e-115 333 66 1 253 3 thiG Thiazole synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64TA0 4.75e-115 333 64 1 253 3 thiG Thiazole synthase Bacteroides fragilis (strain YCH46)
Q5LCA6 4.75e-115 333 64 1 253 3 thiG Thiazole synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q12NB8 5.32e-115 333 65 0 252 3 thiG Thiazole synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B2RH32 1.47e-114 332 64 1 255 3 thiG Thiazole synthase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q7MT73 5.8e-113 328 64 2 254 3 thiG Thiazole synthase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q3A7P5 7.71e-104 305 61 0 251 3 thiG1 Thiazole synthase 1 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3A6Y9 8.98e-104 304 61 0 251 3 thiG2 Thiazole synthase 2 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q8D249 1.71e-102 301 58 0 253 3 thiG Thiazole synthase Wigglesworthia glossinidia brevipalpis
A0LJA4 5.08e-101 297 60 0 251 3 thiG Thiazole synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2RHX4 1.2e-94 281 55 1 251 3 thiG Thiazole synthase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q6AMF7 8.4e-94 279 58 0 249 3 thiG Thiazole synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q8KEJ1 7.36e-93 276 54 1 254 3 thiG Thiazole synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A8LFH1 1.85e-92 277 58 4 258 3 thiG Thiazole synthase Parafrankia sp. (strain EAN1pec)
A4SFW2 1.99e-92 276 53 1 253 3 thiG Thiazole synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q3AR47 7.69e-92 274 53 2 254 3 thiG Thiazole synthase Chlorobium chlorochromatii (strain CaD3)
A1BEF7 5.32e-90 270 53 1 254 3 thiG Thiazole synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3QMD7 2.86e-89 268 53 1 254 3 thiG Thiazole synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B3EH68 2.92e-89 268 55 1 253 3 thiG Thiazole synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A6TVU7 4.62e-89 267 52 1 251 3 thiG Thiazole synthase Alkaliphilus metalliredigens (strain QYMF)
A3DD04 4.72e-88 264 54 1 251 3 thiG Thiazole synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q186R1 9.58e-87 261 52 2 255 3 thiG Thiazole synthase Clostridioides difficile (strain 630)
P58262 7.96e-86 259 53 2 252 3 thiG Thiazole synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A5N8P8 8.31e-86 258 52 1 251 3 thiG Thiazole synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q9RYY1 9.66e-85 256 54 1 248 3 thiG Thiazole synthase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q7V9A2 1.04e-84 256 51 2 259 3 thiG Thiazole synthase Prochlorococcus marinus (strain MIT 9313)
B4SCL0 3.21e-84 254 51 1 254 3 thiG Thiazole synthase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
B3EK52 3.91e-84 254 51 1 253 3 thiG Thiazole synthase Chlorobium phaeobacteroides (strain BS1)
Q1IX18 4.64e-84 254 54 1 247 3 thiG Thiazole synthase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B0C390 3.08e-83 253 53 3 254 3 thiG Thiazole synthase Acaryochloris marina (strain MBIC 11017)
Q112X4 9.05e-83 252 51 3 255 3 thiG Thiazole synthase Trichodesmium erythraeum (strain IMS101)
Q3B0V2 1.05e-82 251 51 2 258 3 thiG Thiazole synthase Synechococcus sp. (strain CC9902)
Q7UA46 2.1e-82 251 51 2 258 3 thiG Thiazole synthase Parasynechococcus marenigrum (strain WH8102)
Q893R2 8.45e-82 248 50 2 252 3 thiG Thiazole synthase Clostridium tetani (strain Massachusetts / E88)
Q2J8F9 2.14e-81 250 55 4 257 3 thiG Thiazole synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q0SSM0 2.49e-81 247 49 1 251 3 thiG Thiazole synthase Clostridium perfringens (strain SM101 / Type A)
Q0TQ02 3.03e-81 247 49 1 251 3 thiG Thiazole synthase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A5D4K1 5.1e-81 246 54 1 251 3 thiG Thiazole synthase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q8XK02 7e-81 246 49 1 251 3 thiG Thiazole synthase Clostridium perfringens (strain 13 / Type A)
Q5WH85 1.06e-80 246 51 1 252 3 thiG Thiazole synthase Shouchella clausii (strain KSM-K16)
Q3ANJ9 3.64e-80 245 52 2 258 3 thiG Thiazole synthase Synechococcus sp. (strain CC9605)
Q8DMP6 4.86e-80 244 53 3 260 3 thiG Thiazole synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q55710 9.14e-80 255 53 3 260 3 thiO/thiG Bifunctional protein ThiO/ThiG Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A3PFF2 1.32e-79 243 50 1 252 3 thiG Thiazole synthase Prochlorococcus marinus (strain MIT 9301)
Q8FP52 1.33e-79 243 51 0 246 3 thiG Thiazole synthase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q5N3I3 2.31e-79 243 53 3 260 3 thiG Thiazole synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31QR1 2.78e-79 243 53 3 260 3 thiG Thiazole synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q317X8 4.83e-79 242 49 1 252 3 thiG1 Thiazole synthase Prochlorococcus marinus (strain MIT 9312)
C3PH66 6.3e-79 241 52 0 246 3 thiG Thiazole synthase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
A4IKR6 1.28e-78 240 54 1 249 3 thiG Thiazole synthase Geobacillus thermodenitrificans (strain NG80-2)
Q9KCY6 2.02e-78 240 50 1 252 3 thiG Thiazole synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7NJM5 2.2e-78 240 51 3 260 3 thiG Thiazole synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7UZJ9 2.85e-78 240 50 3 255 3 thiG Thiazole synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A2BZ50 4.17e-78 239 50 3 259 3 thiG Thiazole synthase Prochlorococcus marinus (strain MIT 9515)
A8G7G9 1.56e-77 238 49 1 252 3 thiG Thiazole synthase Prochlorococcus marinus (strain MIT 9215)
A4J0M0 1.99e-77 237 51 1 252 3 thiG Thiazole synthase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A5GHR6 2.08e-77 238 50 2 255 3 thiG Thiazole synthase Synechococcus sp. (strain WH7803)
B3QUZ7 2.61e-77 237 50 1 247 3 thiG Thiazole synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A2BTP5 3.13e-77 237 49 1 252 3 thiG Thiazole synthase Prochlorococcus marinus (strain AS9601)
A4QFA8 3.25e-77 237 50 2 254 3 thiG Thiazole synthase Corynebacterium glutamicum (strain R)
A0QLT3 4.15e-77 236 54 1 246 3 thiG Thiazole synthase Mycobacterium avium (strain 104)
Q3M859 4.64e-77 248 52 3 255 3 thiO/thiG Bifunctional protein ThiO/ThiG Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q73T20 5.04e-77 236 54 1 246 3 thiG Thiazole synthase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q7V9K9 8.11e-77 236 46 2 257 3 thiG Thiazole synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q46IC6 8.88e-77 236 45 4 262 3 thiG Thiazole synthase Prochlorococcus marinus (strain NATL2A)
Q9S2N4 9.21e-77 236 50 1 246 3 thiG Thiazole synthase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A2C5C9 1.18e-76 236 45 4 262 3 thiG Thiazole synthase Prochlorococcus marinus (strain NATL1A)
Q8YRC9 1.19e-76 247 52 3 255 3 thiO/thiG Bifunctional protein ThiO/ThiG Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8NNY6 1.7e-76 235 50 2 254 3 thiG Thiazole synthase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q47R37 1.93e-76 235 52 1 246 3 thiG Thiazole synthase Thermobifida fusca (strain YX)
Q82AG5 4.76e-76 234 49 1 246 3 thiG Thiazole synthase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B2V959 5.07e-76 234 47 1 253 3 thiG Thiazole synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
B7GEY2 5.35e-76 234 51 1 248 3 thiG Thiazole synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A9EXF3 1e-75 233 48 1 255 3 thiG Thiazole synthase Sorangium cellulosum (strain So ce56)
C5D6J1 1.06e-75 233 51 1 249 3 thiG Thiazole synthase Geobacillus sp. (strain WCH70)
B1VZU6 1.74e-75 233 48 2 249 3 thiG Thiazole synthase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q5L2C0 1.81e-75 232 52 1 248 3 thiG Thiazole synthase Geobacillus kaustophilus (strain HTA426)
C0QUK5 3.34e-75 232 47 1 253 3 thiG Thiazole synthase Persephonella marina (strain DSM 14350 / EX-H1)
A7HA08 5.8e-75 231 50 0 251 3 thiG Thiazole synthase Anaeromyxobacter sp. (strain Fw109-5)
Q311P4 1.44e-74 230 49 3 255 3 thiG Thiazole synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B0TG92 2.67e-74 229 49 1 253 3 thiG Thiazole synthase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q0AQ76 3.73e-74 229 47 4 258 3 thiG Thiazole synthase Maricaulis maris (strain MCS10)
B2HQ02 3.96e-74 229 53 1 246 3 thiG Thiazole synthase Mycobacterium marinum (strain ATCC BAA-535 / M)
A8IEY6 7.03e-74 229 47 1 253 3 thiG Thiazole synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q3SPS2 1.34e-73 228 49 3 251 3 thiG Thiazole synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q5YNQ2 1.81e-73 227 53 1 246 3 thiG Thiazole synthase Nocardia farcinica (strain IFM 10152)
B4UIG2 2.62e-73 227 49 2 253 3 thiG Thiazole synthase Anaeromyxobacter sp. (strain K)
B8JH75 2.62e-73 227 49 2 253 3 thiG Thiazole synthase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IKW1 3.18e-73 227 50 2 252 3 thiG Thiazole synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
B8IPG1 3.72e-73 227 47 1 253 3 thiG Thiazole synthase Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
C6E0C4 4.12e-73 226 47 1 253 3 thiG Thiazole synthase Geobacter sp. (strain M21)
Q1QJD6 6.73e-73 226 49 3 251 3 thiG Thiazole synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A5EPQ3 8.36e-73 226 49 2 250 3 thiG Thiazole synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A8FC15 1.07e-72 225 50 1 248 3 thiG Thiazole synthase Bacillus pumilus (strain SAFR-032)
Q63FR5 1.3e-72 225 50 1 249 3 thiG Thiazole synthase Bacillus cereus (strain ZK / E33L)
A0RA08 1.3e-72 225 50 1 249 3 thiG Thiazole synthase Bacillus thuringiensis (strain Al Hakam)
Q74FL9 1.54e-72 225 47 1 253 3 thiG Thiazole synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B7JRB1 1.98e-72 224 50 1 249 3 thiG Thiazole synthase Bacillus cereus (strain AH820)
Q81UX4 1.98e-72 224 50 1 249 3 thiG Thiazole synthase Bacillus anthracis
C3LFA6 1.98e-72 224 50 1 249 3 thiG Thiazole synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P0L4 1.98e-72 224 50 1 249 3 thiG Thiazole synthase Bacillus anthracis (strain A0248)
A0PRX9 3.24e-72 224 52 1 246 3 thiG Thiazole synthase Mycobacterium ulcerans (strain Agy99)
Q72KN9 4.72e-72 224 50 5 253 3 thiG Thiazole synthase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P51361 5.19e-72 224 47 3 255 3 thiG Thiazole synthase Porphyra purpurea
Q2S371 6.56e-72 224 46 3 257 3 thiG Thiazole synthase Salinibacter ruber (strain DSM 13855 / M31)
B7HDF2 6.78e-72 223 50 2 251 3 thiG Thiazole synthase Bacillus cereus (strain B4264)
B7IY02 6.78e-72 223 50 2 251 3 thiG Thiazole synthase Bacillus cereus (strain G9842)
Q65L94 6.79e-72 223 50 1 248 3 thiG Thiazole synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q81HQ5 7.55e-72 223 50 2 251 3 thiG Thiazole synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HN84 7.88e-72 223 50 2 251 3 thiG Thiazole synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q5SKG7 8.04e-72 223 50 5 253 1 thiG Thiazole synthase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P9WG73 8.38e-72 223 52 1 246 1 thiG Thiazole synthase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
A5TZE3 8.38e-72 223 52 1 246 3 thiG Thiazole synthase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q0ACP4 9.75e-72 223 50 5 256 3 thiG Thiazole synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B4STS6 1.26e-71 223 49 5 261 3 thiG Thiazole synthase Stenotrophomonas maltophilia (strain R551-3)
O31618 1.29e-71 223 50 1 248 1 thiG Thiazole synthase Bacillus subtilis (strain 168)
C1EYJ3 1.33e-71 223 49 2 251 3 thiG Thiazole synthase Bacillus cereus (strain 03BB102)
Q7VF28 1.35e-71 223 45 2 253 3 thiG Thiazole synthase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q73DB1 1.47e-71 223 50 2 251 3 thiG Thiazole synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
P9WG72 1.72e-71 222 52 1 246 3 thiG Thiazole synthase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
C1AK93 1.72e-71 222 52 1 246 3 thiG Thiazole synthase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KFN9 1.72e-71 222 52 1 246 3 thiG Thiazole synthase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P59948 1.72e-71 222 52 1 246 3 thiG Thiazole synthase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q39RH2 1.76e-71 222 46 1 252 3 thiG Thiazole synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q2SQL5 2e-71 222 47 2 248 3 thiG Thiazole synthase Hahella chejuensis (strain KCTC 2396)
B0UHP4 2.37e-71 222 47 1 253 3 thiG Thiazole synthase Methylobacterium sp. (strain 4-46)
B2FSD0 2.37e-71 222 49 5 261 3 thiG Thiazole synthase Stenotrophomonas maltophilia (strain K279a)
Q9ZBL2 2.68e-71 222 52 1 246 3 thiG Thiazole synthase Mycobacterium leprae (strain TN)
B8ZU92 2.68e-71 222 52 1 246 3 thiG Thiazole synthase Mycobacterium leprae (strain Br4923)
A9VFL4 2.76e-71 222 50 2 251 3 thiG Thiazole synthase Bacillus mycoides (strain KBAB4)
Q1D7A6 2.99e-71 222 46 1 252 3 thiG Thiazole synthase Myxococcus xanthus (strain DK1622)
Q8RI63 3.32e-71 221 46 5 258 3 thiG Thiazole synthase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
B9J523 4.08e-71 221 49 2 251 3 thiG Thiazole synthase Bacillus cereus (strain Q1)
B7HWF4 4.08e-71 221 49 2 251 3 thiG Thiazole synthase Bacillus cereus (strain AH187)
Q6NKI6 5.33e-71 221 47 2 255 3 thiG Thiazole synthase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A6LTL5 5.85e-71 221 47 4 253 3 thiG Thiazole synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q8G5F6 7.61e-71 221 48 4 252 3 thiG Thiazole synthase Bifidobacterium longum (strain NCC 2705)
A4YZQ4 7.64e-71 221 47 3 251 3 thiG Thiazole synthase Bradyrhizobium sp. (strain ORS 278)
Q89FP2 1.27e-70 220 48 2 250 3 thiG Thiazole synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q1XDC6 2.23e-70 220 47 3 255 3 thiG Thiazole synthase Neopyropia yezoensis
Q133T5 2.32e-70 219 46 2 250 3 thiG Thiazole synthase Rhodopseudomonas palustris (strain BisB5)
A5G7P4 2.39e-70 219 45 1 248 3 thiG Thiazole synthase Geotalea uraniireducens (strain Rf4)
B5ED95 2.42e-70 219 45 1 253 3 thiG Thiazole synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A8M4E3 2.73e-70 219 49 1 245 3 thiG Thiazole synthase Salinispora arenicola (strain CNS-205)
Q5NPJ8 3.63e-70 219 49 2 255 3 thiG Thiazole synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A0T0L1 6.28e-70 219 47 3 255 3 thiG Thiazole synthase Phaeodactylum tricornutum (strain CCAP 1055/1)
O19915 6.59e-70 218 44 3 262 3 thiG Thiazole synthase Cyanidium caldarium
Q3IFN6 6.91e-70 218 44 1 247 3 thiG Thiazole synthase Pseudoalteromonas translucida (strain TAC 125)
B8GQT0 7.13e-70 218 48 5 257 3 thiG Thiazole synthase Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A0QQL0 9.31e-70 218 52 1 247 1 thiG Thiazole synthase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q6N3W7 1.32e-69 218 46 2 250 3 thiG Thiazole synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q87AE8 1.63e-69 218 49 6 261 3 thiG Thiazole synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q01NZ1 1.95e-69 217 49 2 255 3 thiG Thiazole synthase Solibacter usitatus (strain Ellin6076)
A7GLF8 2.33e-69 217 47 2 251 3 thiG Thiazole synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8P632 2.71e-69 217 49 5 261 3 thiG Thiazole synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RPJ1 2.71e-69 217 49 5 261 3 thiG Thiazole synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UXY4 2.71e-69 217 49 5 261 3 thiG Thiazole synthase Xanthomonas campestris pv. campestris (strain 8004)
B3QFS7 2.73e-69 217 45 2 250 3 thiG Thiazole synthase Rhodopseudomonas palustris (strain TIE-1)
A0T103 3.57e-69 217 47 3 256 3 thiG Thiazole synthase Thalassiosira pseudonana
Q2IYP6 4.81e-69 216 46 3 251 3 thiG Thiazole synthase Rhodopseudomonas palustris (strain HaA2)
C1DI61 5.21e-69 216 47 2 254 3 thiG Thiazole synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B1YES2 5.64e-69 216 49 1 252 3 thiG Thiazole synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q9PF95 7.71e-69 216 49 6 261 3 thiG Thiazole synthase Xylella fastidiosa (strain 9a5c)
A4XZZ8 8.32e-69 216 47 2 254 3 thiG Thiazole synthase Pseudomonas mendocina (strain ymp)
Q5GXE5 8.68e-69 216 48 5 261 3 thiG Thiazole synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SWK7 8.68e-69 216 48 5 261 3 thiG Thiazole synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P0J5 8.68e-69 216 48 5 261 3 thiG Thiazole synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q2GDS9 1.04e-68 215 46 2 249 3 thiG Thiazole synthase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q3JAP1 1.67e-68 215 47 2 250 3 thiG Thiazole synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q3BQ15 2.63e-68 214 48 5 261 3 thiG Thiazole synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B5YJ73 3.57e-68 214 46 1 252 3 thiG Thiazole synthase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q07PW9 4.14e-68 214 45 2 250 3 thiG Thiazole synthase Rhodopseudomonas palustris (strain BisA53)
Q216G8 4.32e-68 214 46 2 250 3 thiG Thiazole synthase Rhodopseudomonas palustris (strain BisB18)
A8ER78 4.57e-68 214 42 2 254 3 thiG Thiazole synthase Aliarcobacter butzleri (strain RM4018)
Q9I6B4 8.58e-68 213 48 3 257 1 thiG Thiazole synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02U32 8.58e-68 213 48 3 257 3 thiG Thiazole synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3W7 8.58e-68 213 48 3 257 3 thiG Thiazole synthase Pseudomonas aeruginosa (strain LESB58)
Q8PHF5 8.79e-68 213 47 5 261 3 thiG Thiazole synthase Xanthomonas axonopodis pv. citri (strain 306)
B1VH27 1.03e-67 213 45 1 265 3 thiG Thiazole synthase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
O67926 1.03e-67 213 45 2 250 3 thiG Thiazole synthase Aquifex aeolicus (strain VF5)
B3PIG8 1.05e-67 213 45 2 241 3 thiG Thiazole synthase Cellvibrio japonicus (strain Ueda107)
Q4JVZ5 1.95e-67 213 46 1 265 3 thiG Thiazole synthase Corynebacterium jeikeium (strain K411)
B9L7B6 2.46e-67 212 42 2 254 3 thiG Thiazole synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q2G348 2.8e-67 211 44 2 254 3 thiG Thiazole synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A4VRK5 3e-67 212 46 3 257 3 thiG Thiazole synthase Stutzerimonas stutzeri (strain A1501)
Q3K587 4.29e-67 211 47 2 254 3 thiG Thiazole synthase Pseudomonas fluorescens (strain Pf0-1)
A6UYJ0 4.88e-67 211 48 3 257 3 thiG Thiazole synthase Pseudomonas aeruginosa (strain PA7)
A6WVK9 6.03e-67 211 46 2 250 3 thiG Thiazole synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B1J2G8 8.51e-67 211 47 3 257 3 thiG Thiazole synthase Pseudomonas putida (strain W619)
A0L5E8 1.3e-66 212 47 4 253 3 thiG Thiazole synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
C3K3L7 2.14e-66 209 47 2 254 3 thiG Thiazole synthase Pseudomonas fluorescens (strain SBW25)
Q7M9F6 2.28e-66 209 44 2 248 3 thiG Thiazole synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B2U764 3.23e-66 209 44 2 253 3 thiG Thiazole synthase Ralstonia pickettii (strain 12J)
Q82XI7 3.43e-66 209 48 6 256 3 thiG Thiazole synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P49570 3.47e-66 209 47 3 237 3 thiG Thiazole synthase Trieres chinensis
Q4K4C5 5.39e-66 208 47 3 257 3 thiG Thiazole synthase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4G387 8.83e-66 208 45 2 258 3 thiG Thiazole synthase Emiliania huxleyi
Q83EI7 1.14e-65 207 43 1 249 3 thiG Thiazole synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB65 1.14e-65 207 43 1 249 3 thiG Thiazole synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q6AAE4 1.15e-65 208 45 1 251 3 thiG Thiazole synthase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A9KGN4 1.74e-65 207 43 1 249 3 thiG Thiazole synthase Coxiella burnetii (strain Dugway 5J108-111)
B6J1X5 1.74e-65 207 43 1 249 3 thiG Thiazole synthase Coxiella burnetii (strain CbuG_Q212)
B6J5W6 1.74e-65 207 43 1 249 3 thiG Thiazole synthase Coxiella burnetii (strain CbuK_Q154)
A6Q1C9 2.46e-65 207 42 2 249 3 thiG Thiazole synthase Nitratiruptor sp. (strain SB155-2)
Q4ZM55 3.41e-65 206 46 3 257 3 thiG Thiazole synthase Pseudomonas syringae pv. syringae (strain B728a)
Q48CL9 3.41e-65 206 46 3 257 3 thiG Thiazole synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q31JD2 3.69e-65 207 42 2 249 3 thiG Thiazole synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q88AF6 5.1e-65 206 46 3 257 3 thiG Thiazole synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8Y372 7.2e-65 206 43 2 253 3 thiG Thiazole synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2YCZ2 1.11e-64 205 46 6 264 3 thiG Thiazole synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B8GWN0 1.15e-64 205 46 3 254 3 thiG Thiazole synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A746 1.15e-64 205 46 3 254 3 thiG Thiazole synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2RRL3 1.3e-64 206 44 2 255 3 thiG Thiazole synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B5ENK9 1.38e-64 205 45 1 253 3 thiG Thiazole synthase Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J5U0 1.38e-64 205 45 1 253 3 thiG Thiazole synthase Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0AJ67 2.12e-64 204 47 6 256 3 thiG Thiazole synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A8FM94 2.39e-64 204 46 4 251 3 thiG Thiazole synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7Z3F8 3.44e-64 204 49 1 248 3 thiG Thiazole synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q49UF2 4.31e-64 203 43 2 250 3 thiG Thiazole synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A1W035 4.43e-64 203 46 4 251 3 thiG Thiazole synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q5FNT5 4.73e-64 203 48 3 242 3 thiG Thiazole synthase Gluconobacter oxydans (strain 621H)
Q5HU56 7.22e-64 203 45 4 251 3 thiG Thiazole synthase Campylobacter jejuni (strain RM1221)
B0SXB0 7.46e-64 203 46 3 254 3 thiG Thiazole synthase Caulobacter sp. (strain K31)
Q9PNP6 9.37e-64 202 45 4 251 3 thiG Thiazole synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q2W3R9 9.53e-64 205 44 2 255 3 thiG Thiazole synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q85G31 9.58e-64 202 46 2 235 3 thiG Thiazole synthase Cyanidioschyzon merolae (strain NIES-3377 / 10D)
Q609Z5 9.63e-64 203 45 5 260 3 thiG Thiazole synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q6B924 1.12e-63 203 44 2 254 3 thiG Thiazole synthase Gracilaria tenuistipitata var. liui
Q1QE71 1.46e-63 202 42 3 257 3 thiG Thiazole synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q5P5J1 2.47e-63 201 46 5 263 3 thiG Thiazole synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q88CS6 3.7e-63 201 45 2 260 3 thiG Thiazole synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KN58 3.7e-63 201 45 2 260 3 thiG Thiazole synthase Pseudomonas putida (strain GB-1)
A5WAD7 3.7e-63 201 45 2 260 3 thiG Thiazole synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4FV61 5.29e-63 201 42 3 257 3 thiG Thiazole synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A9HI56 7.9e-63 200 44 2 244 3 thiG Thiazole synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q9F812 8.31e-63 200 46 3 239 3 thiG Thiazole synthase Erwinia amylovora
B9E9B4 1.03e-62 200 44 2 250 3 thiG Thiazole synthase Macrococcus caseolyticus (strain JCSC5402)
Q30U33 1.24e-62 200 41 2 254 3 thiG Thiazole synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q1IGD3 1.29e-62 200 44 2 260 3 thiG Thiazole synthase Pseudomonas entomophila (strain L48)
Q8CN30 1.86e-62 199 43 2 250 3 thiG Thiazole synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B9DKG1 2.19e-62 199 43 2 250 3 thiG Thiazole synthase Staphylococcus carnosus (strain TM300)
Q57FG5 2.47e-62 199 46 2 250 3 thiG Thiazole synthase Brucella abortus biovar 1 (strain 9-941)
Q2YP58 2.47e-62 199 46 2 250 3 thiG Thiazole synthase Brucella abortus (strain 2308)
B2S8J9 2.47e-62 199 46 2 250 3 thiG Thiazole synthase Brucella abortus (strain S19)
A5CVZ0 2.67e-62 199 43 5 260 3 thiG Thiazole synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q5WWJ5 3.09e-62 199 43 3 251 3 thiG Thiazole synthase Legionella pneumophila (strain Lens)
Q4FMP0 3.52e-62 198 42 4 258 3 thiG Thiazole synthase Pelagibacter ubique (strain HTCC1062)
Q4L904 3.82e-62 198 42 3 258 3 thiG Thiazole synthase Staphylococcus haemolyticus (strain JCSC1435)
A5VNE4 5.1e-62 198 46 2 250 3 thiG Thiazole synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q1GXY7 5.71e-62 198 44 5 259 3 thiG Thiazole synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A1TRP8 5.88e-62 198 42 1 249 3 thiG Thiazole synthase Paracidovorax citrulli (strain AAC00-1)
A7H2Z6 6.18e-62 198 44 4 251 3 thiG Thiazole synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
Q8YEZ2 6.55e-62 198 45 2 250 3 thiG Thiazole synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RGR3 6.55e-62 198 45 2 250 3 thiG Thiazole synthase Brucella melitensis biotype 2 (strain ATCC 23457)
B0V876 6.84e-62 198 43 4 257 3 thiG Thiazole synthase Acinetobacter baumannii (strain AYE)
A3M6Z4 6.84e-62 198 43 4 257 3 thiG Thiazole synthase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HUU9 6.84e-62 198 43 4 257 3 thiG Thiazole synthase Acinetobacter baumannii (strain ACICU)
B7I2M9 6.84e-62 198 43 4 257 3 thiG Thiazole synthase Acinetobacter baumannii (strain AB0057)
B7GZV4 6.84e-62 198 43 4 257 3 thiG Thiazole synthase Acinetobacter baumannii (strain AB307-0294)
B0CJ70 7.07e-62 197 46 2 250 3 thiG Thiazole synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5IC64 9.65e-62 197 43 3 251 3 thiG Thiazole synthase Legionella pneumophila (strain Corby)
Q5HLB4 1e-61 197 42 2 250 3 thiG Thiazole synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q48A93 1.03e-61 197 43 4 254 3 thiG Thiazole synthase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q63Q73 1.24e-61 197 43 2 249 3 thiG Thiazole synthase Burkholderia pseudomallei (strain K96243)
Q3JMY2 1.24e-61 197 43 2 249 3 thiG Thiazole synthase Burkholderia pseudomallei (strain 1710b)
Q62GC6 1.24e-61 197 43 2 249 3 thiG Thiazole synthase Burkholderia mallei (strain ATCC 23344)
Q39KA4 1.24e-61 197 44 3 250 3 thiG Thiazole synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q2SU89 1.26e-61 197 43 2 249 3 thiG Thiazole synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q476U3 1.4e-61 197 43 2 245 3 thiG Thiazole synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KF31 1.56e-61 197 43 2 245 3 thiG Thiazole synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q478Z2 1.63e-61 197 44 4 260 3 thiG Thiazole synthase Dechloromonas aromatica (strain RCB)
Q7VTE5 1.72e-61 197 44 6 263 3 thiG Thiazole synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3P5 2.23e-61 197 44 6 264 3 thiG Thiazole synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q8G2U9 2.57e-61 196 45 2 250 3 thiG Thiazole synthase Brucella suis biovar 1 (strain 1330)
A9M7F3 2.57e-61 196 45 2 250 3 thiG Thiazole synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7WF21 2.93e-61 196 44 6 264 3 thiG Thiazole synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3SH10 4.5e-61 196 45 5 258 3 thiG Thiazole synthase Thiobacillus denitrificans (strain ATCC 25259)
Q5X4Z5 4.85e-61 196 42 3 251 3 thiG Thiazole synthase Legionella pneumophila (strain Paris)
Q5F5C4 5.24e-61 196 42 3 250 3 thiG Thiazole synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q7US84 6.05e-61 196 46 3 258 3 thiG Thiazole synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B0VKA4 6.52e-61 195 43 4 257 3 thiG Thiazole synthase Acinetobacter baumannii (strain SDF)
Q1LS25 8.06e-61 196 42 2 249 3 thiG Thiazole synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q6FCN1 8.83e-61 195 43 4 257 3 thiG Thiazole synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9JWI4 1.88e-60 194 41 3 250 3 thiG Thiazole synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1KWF0 2.07e-60 194 42 3 250 3 thiG Thiazole synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXF5 2.07e-60 194 42 3 250 3 thiG Thiazole synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KCM9 3.24e-60 194 45 5 260 3 thiG Thiazole synthase Azoarcus sp. (strain BH72)
A9M072 7.87e-60 192 41 3 250 3 thiG Thiazole synthase Neisseria meningitidis serogroup C (strain 053442)
A1AY12 9.87e-60 192 44 2 249 3 thiG Thiazole synthase Paracoccus denitrificans (strain Pd 1222)
Q7NRL4 3.53e-59 191 45 3 250 3 thiG Thiazole synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2KUI1 3.07e-58 189 44 3 238 3 thiG Thiazole synthase Bordetella avium (strain 197N)
Q5LWJ1 3.97e-58 188 43 2 249 3 thiG Thiazole synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
C5CJH0 4.61e-58 189 41 1 251 3 thiG Thiazole synthase Variovorax paradoxus (strain S110)
Q98AZ6 1.02e-56 184 41 3 251 3 thiG Thiazole synthase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q16C60 2.17e-56 184 44 2 244 3 thiG Thiazole synthase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1US08 2.5e-55 181 40 3 252 3 thiG Thiazole synthase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B4RCS1 2.62e-55 181 46 4 257 3 thiG Thiazole synthase Phenylobacterium zucineum (strain HLK1)
B2AGF6 9.87e-55 180 42 2 245 3 thiG Thiazole synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q8GEI4 1.03e-54 179 43 3 239 3 thiG Thiazole synthase Erwinia pyrifoliae (strain DSM 12162 / Ep1/96)
Q6G480 1.14e-54 179 41 4 253 3 thiG Thiazole synthase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A9IRH0 2.62e-54 178 41 4 253 3 thiG Thiazole synthase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8UCD2 2.35e-53 176 41 3 255 3 thiG Thiazole synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
B2VD79 2.35e-53 176 44 2 239 3 thiG Thiazole synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B9JMX8 4.59e-53 175 42 3 251 3 thiG Thiazole synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
P58264 1.47e-52 174 43 3 251 3 thiG Thiazole synthase Rhizobium meliloti (strain 1021)
Q6G0A2 1.61e-49 166 42 4 253 3 thiG Thiazole synthase Bartonella quintana (strain Toulouse)
O34293 1.15e-47 161 40 2 250 3 thiG Thiazole synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B9K256 7.64e-47 159 41 2 250 3 thiG Thiazole synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_18245
Feature type CDS
Gene thiG
Product Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)
Location 19151 - 19918 (strand: 1)
Length 768 (nucleotides) / 255 (amino acids)
In genomic island -

Contig

Accession ZDB_382
Length 38736 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2327
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05690 Thiazole biosynthesis protein ThiG

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2022 Coenzyme transport and metabolism (H) H Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)

Kegg Ortholog Annotation(s)

Protein Sequence

MLTIADTTFTSHLFTGTGKYTSSRVMQEAIAASGSQLVTMAMKRIDLSQGHDDILAPLRELGIKLLPNTSGANNAREAVFAAQLAREALGTNWIKLEIHPDARYLLPDPVETLAAAEILVKEGFIVLPYCSADPVLCRRLQEAGCAAVMPLGAPIGSNQGLQTRDMLRIIIEQATVPVVIDAGIGAPSHALEAIELGADAVLVNTAMAVARSPVTMAKAFRQAIEAGLLAREAELAPKQQQASASSPLTSFLGAL

Flanking regions ( +/- flanking 50bp)

CGCGACGGCGATCAGATTTTACTTTTTCAGGCTATCGCAGGAGGTTAATGATGCTGACGATTGCAGATACCACATTTACGTCCCATTTATTTACCGGCACCGGGAAATACACCAGCAGCCGGGTTATGCAGGAGGCGATTGCCGCCTCCGGCAGCCAGTTAGTCACCATGGCGATGAAGCGTATCGATCTTTCTCAGGGACATGACGATATCCTTGCCCCGCTCCGTGAACTCGGTATTAAACTGCTGCCGAATACTTCCGGTGCAAACAATGCCCGGGAAGCGGTGTTTGCCGCACAACTGGCGCGGGAAGCACTCGGCACCAACTGGATCAAACTGGAGATCCACCCCGATGCCCGCTACCTGCTGCCGGACCCGGTTGAAACCCTGGCTGCGGCAGAAATACTGGTGAAAGAGGGGTTTATTGTCCTGCCTTATTGCAGTGCGGATCCGGTATTATGCCGCCGGTTGCAGGAGGCCGGATGCGCCGCCGTTATGCCGCTGGGTGCGCCTATCGGCTCCAATCAGGGATTACAGACCCGCGATATGCTGCGCATTATTATTGAGCAGGCAACGGTTCCGGTAGTGATTGATGCCGGGATTGGCGCACCAAGCCACGCCCTCGAGGCGATAGAACTGGGCGCGGATGCTGTGCTGGTCAATACCGCGATGGCCGTTGCCCGCTCACCGGTCACCATGGCAAAAGCATTCCGTCAGGCCATTGAGGCCGGGCTGCTGGCGCGGGAGGCCGAGCTGGCACCGAAGCAGCAACAGGCATCGGCATCCAGCCCGCTGACCTCATTCCTGGGAGCATTGTGATGAGTGAAAAAACCTTCAGTGACCGCTGGCAGCAGCTGGACTGGGATGAT