Homologs in group_2161

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15955 FBDBKF_15955 100.0 Morganella morganii S1 - Histone-like protein
EHELCC_18555 EHELCC_18555 100.0 Morganella morganii S2 - Histone-like protein
NLDBIP_17390 NLDBIP_17390 100.0 Morganella morganii S4 - Histone-like protein
HKOGLL_17125 HKOGLL_17125 100.0 Morganella morganii S5 - Histone-like protein
F4V73_RS16355 F4V73_RS16355 95.5 Morganella psychrotolerans - HHA domain-containing protein
PMI_RS00625 PMI_RS00625 97.0 Proteus mirabilis HI4320 - HHA domain-containing protein

Distribution of the homologs in the orthogroup group_2161

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2161

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A3X0 1.39e-37 122 85 0 67 1 ymoA Modulating protein YmoA Yersinia pestis
P0A3X1 1.39e-37 122 85 0 67 1 ymoA Modulating protein YmoA Yersinia enterocolitica
P0ACE6 1.46e-37 122 83 0 67 3 hha Hemolysin expression-modulating protein Hha Shigella flexneri
P0ACE3 1.46e-37 122 83 0 67 1 hha Hemolysin expression-modulating protein Hha Escherichia coli (strain K12)
P0ACE4 1.46e-37 122 83 0 67 3 hha Hemolysin expression-modulating protein Hha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACE5 1.46e-37 122 83 0 67 3 hha Hemolysin expression-modulating protein Hha Escherichia coli O157:H7
Q7CR17 1.63e-37 122 83 0 67 1 hha Hemolysin expression-modulating protein Hha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3N8G7 1.63e-37 122 83 0 67 3 hha Hemolysin expression-modulating protein Hha Salmonella typhimurium (strain SL1344)
Q3Z1Y0 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Shigella sonnei (strain Ss046)
P64470 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Shigella flexneri
Q0T4F2 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Shigella flexneri serotype 5b (strain 8401)
Q32FE8 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Shigella dysenteriae serotype 1 (strain Sd197)
Q320Y2 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Shigella boydii serotype 4 (strain Sb227)
Q1RBH1 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Escherichia coli (strain UTI89 / UPEC)
P64467 1.71e-13 61 47 3 71 1 cnu OriC-binding nucleoid-associated protein Escherichia coli (strain K12)
P64468 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THK2 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P64469 1.71e-13 61 47 3 71 3 cnu OriC-binding nucleoid-associated protein Escherichia coli O157:H7
Q7CQK5 1.8e-13 61 45 3 71 1 ydgT Transcription modulator YdgT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XGJ8 1.8e-13 61 45 3 71 3 ydgT Transcription modulator YdgT Salmonella typhi
Q5PIC3 1.8e-13 61 45 3 71 3 ydgT Transcription modulator YdgT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57PH6 1.8e-13 61 45 3 71 3 ydgT Transcription modulator YdgT Salmonella choleraesuis (strain SC-B67)
A0A0H3NGF1 2.06e-13 61 45 3 71 3 ydgT Transcription modulator YdgT Salmonella typhimurium (strain SL1344)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_17270
Feature type CDS
Gene -
Product Histone-like protein
Location 26195 - 26401 (strand: 1)
Length 207 (nucleotides) / 68 (amino acids)
In genomic island -

Contig

Accession ZDB_378
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2161
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF05321 Haemolysin expression modulating protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05839 haemolysin expression modulating protein - -

Protein Sequence

MMTKLDYLMRLRKCTSIETLERVIEKNKYELTDDELEVFYSAADHRLAELTMNKLYDKIPASVWKFVR

Flanking regions ( +/- flanking 50bp)

ATTTATATATCAGTATATTGCGTACTAACAACTCAGCAAGAAGATAACATATGATGACTAAACTGGACTATCTCATGCGCTTACGTAAGTGCACTTCTATTGAAACACTGGAACGTGTCATTGAGAAGAACAAATATGAACTGACTGATGATGAGCTGGAGGTTTTTTATTCAGCAGCCGACCATCGTCTGGCCGAATTAACCATGAATAAACTGTATGACAAAATCCCGGCATCTGTCTGGAAATTTGTCCGTTAATTCAACCTGCTGTAACCGCCTCTCTTTCAGGCAATAGTCTTATTTTTAGT