Homologs in group_2422

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19545 FBDBKF_19545 100.0 Morganella morganii S1 dgkA Diacylglycerol kinase
EHELCC_16490 EHELCC_16490 100.0 Morganella morganii S2 dgkA Diacylglycerol kinase
NLDBIP_16700 NLDBIP_16700 100.0 Morganella morganii S4 dgkA Diacylglycerol kinase
HKOGLL_18845 HKOGLL_18845 100.0 Morganella morganii S5 dgkA Diacylglycerol kinase
F4V73_RS18580 F4V73_RS18580 79.7 Morganella psychrotolerans - diacylglycerol kinase
PMI_RS13555 PMI_RS13555 62.8 Proteus mirabilis HI4320 - diacylglycerol kinase

Distribution of the homologs in the orthogroup group_2422

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2422

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABN4 1.99e-44 144 62 0 119 3 dgkA Diacylglycerol kinase Shigella flexneri
P0ABN1 1.99e-44 144 62 0 119 1 dgkA Diacylglycerol kinase Escherichia coli (strain K12)
P0ABN2 1.99e-44 144 62 0 119 3 dgkA Diacylglycerol kinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ABN3 1.99e-44 144 62 0 119 3 dgkA Diacylglycerol kinase Escherichia coli O157:H7
P44424 2.85e-32 112 52 0 112 3 dgkA Diacylglycerol kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9HY23 7.37e-26 96 48 0 103 3 dgkA Diacylglycerol kinase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZLE0 2.22e-23 90 47 0 110 3 dgkA Diacylglycerol kinase Helicobacter pylori (strain J99 / ATCC 700824)
P56411 9.71e-23 89 45 1 121 3 dgkA Diacylglycerol kinase Helicobacter pylori (strain ATCC 700392 / 26695)
Q05888 1.08e-10 58 32 4 118 1 dgkA Undecaprenol kinase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P29945 6.49e-07 48 36 2 103 3 dgkA Diacylglycerol kinase Sinorhizobium sp.
Q06119 8.25e-07 48 37 4 108 3 dgkA Diacylglycerol kinase Rhizobium meliloti (strain 1021)
Q55143 0.000199 42 33 1 81 3 dgkA Diacylglycerol kinase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_16770
Feature type CDS
Gene dgkA
Product Diacylglycerol kinase
Location 51028 - 51399 (strand: -1)
Length 372 (nucleotides) / 123 (amino acids)

Contig

Accession ZDB_376
Length 68509 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2422
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01219 Prokaryotic diacylglycerol kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0818 Lipid transport and metabolism (I) I Diacylglycerol kinase

Protein Sequence

MKKNTGFIRLIKAAGYSKKGLIAAWKNEAAIRQELLTLIPAIVIAFAFSFTAVERVLLIGSVVLVVVIELINSAIEAVVDRIGTEYHELSGRAKDMGSAAVFIAALLGLFVWIMLFTSWFLRL

Flanking regions ( +/- flanking 50bp)

GAAAAATAGCGGCGATCAGTCAGATAATCATATTATTTACAGTGACAGAAATGAAAAAAAATACCGGATTTATACGATTAATTAAAGCGGCGGGTTATTCAAAGAAAGGACTCATTGCGGCATGGAAAAATGAAGCCGCTATCCGTCAGGAATTGCTGACGCTGATCCCGGCCATTGTTATTGCCTTTGCTTTCTCTTTTACCGCTGTTGAGCGGGTACTGCTGATTGGTTCTGTGGTGCTGGTGGTAGTGATTGAGCTTATCAACAGCGCTATTGAGGCTGTGGTTGACCGTATCGGTACGGAATATCATGAACTGTCCGGCCGGGCCAAAGATATGGGGTCCGCCGCAGTATTTATCGCCGCATTACTGGGGCTGTTTGTCTGGATTATGCTGTTTACCAGCTGGTTCCTGCGTCTTTAACAGACGATTTTTTGTGAAACCTGCGGCGTAACACGTATTTTCCTCATGTT