Homologs in group_2016

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14850 FBDBKF_14850 100.0 Morganella morganii S1 yeiP elongation factor P-like protein YeiP
EHELCC_15655 EHELCC_15655 100.0 Morganella morganii S2 yeiP elongation factor P-like protein YeiP
NLDBIP_16185 NLDBIP_16185 100.0 Morganella morganii S4 yeiP elongation factor P-like protein YeiP
HKOGLL_14775 HKOGLL_14775 100.0 Morganella morganii S5 yeiP elongation factor P-like protein YeiP
F4V73_RS07650 F4V73_RS07650 92.6 Morganella psychrotolerans yeiP elongation factor P-like protein YeiP
PMI_RS04100 PMI_RS04100 87.9 Proteus mirabilis HI4320 yeiP elongation factor P-like protein YeiP

Distribution of the homologs in the orthogroup group_2016

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2016

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4ETA2 2.47e-124 351 87 0 190 3 PMI0835 Elongation factor P-like protein Proteus mirabilis (strain HI4320)
Q7N360 1.85e-119 338 84 0 190 3 plu2861 Elongation factor P-like protein Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GGU5 6.75e-118 335 83 0 190 3 Spro_3237 Elongation factor P-like protein Serratia proteamaculans (strain 568)
C5BG23 2.46e-117 333 82 0 190 3 NT01EI_2577 Elongation factor P-like protein Edwardsiella ictaluri (strain 93-146)
A1JLS4 5.02e-117 332 84 0 190 3 YE1441 Elongation factor P-like protein Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JS27 5.49e-115 327 83 0 190 3 YPK_2777 Elongation factor P-like protein Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CT6 5.49e-115 327 83 0 190 3 YPTB1316 Elongation factor P-like protein Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNC5 5.49e-115 327 83 0 190 3 YPDSF_2412 Elongation factor P-like protein Yersinia pestis (strain Pestoides F)
Q1CG58 5.49e-115 327 83 0 190 3 YPN_2694 Elongation factor P-like protein Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZGK7 5.49e-115 327 83 0 190 3 YPO1284 Elongation factor P-like protein Yersinia pestis
B2K9G9 5.49e-115 327 83 0 190 3 YPTS_1408 Elongation factor P-like protein Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9A5 5.49e-115 327 83 0 190 3 YPA_1000 Elongation factor P-like protein Yersinia pestis bv. Antiqua (strain Antiqua)
A7FK85 5.49e-115 327 83 0 190 3 YpsIP31758_2698 Elongation factor P-like protein Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VIG6 7.14e-115 327 81 0 190 3 ETA_12720 Elongation factor P-like protein Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6D3L2 2.52e-114 326 82 0 190 3 ECA2732 Elongation factor P-like protein Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DEK5 5.14e-114 325 82 0 190 3 PC1_1649 Elongation factor P-like protein Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MLL9 1.03e-112 322 80 0 190 3 ESA_01069 Elongation factor P-like protein Cronobacter sakazakii (strain ATCC BAA-894)
A8AE51 2.14e-111 318 78 0 190 3 CKO_00610 Elongation factor P-like protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P64046 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64047 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella typhi
B4TPB4 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella schwarzengrund (strain CVM19633)
B5BE26 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella paratyphi A (strain AKU_12601)
C0Q0S9 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella paratyphi C (strain RKS4594)
A9N6H3 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PE39 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SY47 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella newport (strain SL254)
B4TAN5 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella heidelberg (strain SL476)
B5RC50 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R181 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella enteritidis PT4 (strain P125109)
B5FNL7 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella dublin (strain CT_02021853)
A9MK40 5.08e-111 317 78 0 190 3 yeiP Elongation factor P-like protein Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3Z035 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Shigella sonnei (strain Ss046)
Q32HX1 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Shigella dysenteriae serotype 1 (strain Sd197)
B2TVS0 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R9P8 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli (strain UTI89 / UPEC)
B1LKS0 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli (strain SMS-3-5 / SECEC)
B6I8M3 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli (strain SE11)
B7N5D5 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6N8 5.2e-111 317 79 0 190 1 yeiP Elongation factor P-like protein Escherichia coli (strain K12)
B1IY98 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6N9 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TFR8 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AD29 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O1:K1 / APEC
A8A234 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O9:H4 (strain HS)
B1X869 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli (strain K12 / DH10B)
B7M521 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O8 (strain IAI1)
B7MXI6 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O81 (strain ED1a)
B7NMY6 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YWW4 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6P0 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O157:H7
B7LAJ5 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli (strain 55989 / EAEC)
B7MF86 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UFI8 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZNZ5 5.2e-111 317 79 0 190 3 yeiP Elongation factor P-like protein Escherichia coli O139:H28 (strain E24377A / ETEC)
A4WCK1 1.49e-110 316 78 0 190 3 Ent638_2766 Elongation factor P-like protein Enterobacter sp. (strain 638)
Q83KE6 1.98e-110 316 78 0 190 3 yeiP Elongation factor P-like protein Shigella flexneri
Q0T2V0 1.98e-110 316 78 0 190 3 yeiP Elongation factor P-like protein Shigella flexneri serotype 5b (strain 8401)
Q31YX9 1.98e-110 316 78 0 190 3 yeiP Elongation factor P-like protein Shigella boydii serotype 4 (strain Sb227)
B7LJR2 2.19e-110 316 78 0 190 3 yeiP Elongation factor P-like protein Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q57MC8 2.6e-110 315 78 0 190 3 yeiP Elongation factor P-like protein Salmonella choleraesuis (strain SC-B67)
B5XP41 4.66e-109 312 77 0 190 3 KPK_1559 Elongation factor P-like protein Klebsiella pneumoniae (strain 342)
A6TBQ0 2.19e-108 311 77 0 190 3 KPN78578_25600 Elongation factor P-like protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q2SQE7 4.71e-91 267 65 1 190 3 HCH_00211 Elongation factor P-like protein Hahella chejuensis (strain KCTC 2396)
C3LLQ5 8.75e-80 238 57 1 189 3 VCM66_1164 Elongation factor P-like protein Vibrio cholerae serotype O1 (strain M66-2)
Q9KSP7 8.75e-80 238 57 1 189 3 VC_1209 Elongation factor P-like protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1Y2 8.75e-80 238 57 1 189 3 VC0395_A0829 Elongation factor P-like protein Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FE04 3.22e-79 237 58 1 189 3 VFMJ11_1350 Elongation factor P-like protein Aliivibrio fischeri (strain MJ11)
Q5E5C9 7.48e-79 236 58 1 189 3 VF_1272 Elongation factor P-like protein Aliivibrio fischeri (strain ATCC 700601 / ES114)
B6ELB8 1.66e-76 230 57 1 189 3 VSAL_I1536 Elongation factor P-like protein Aliivibrio salmonicida (strain LFI1238)
Q7MM44 3.35e-74 224 54 1 189 3 VV1229 Elongation factor P-like protein Vibrio vulnificus (strain YJ016)
Q8D8C2 3.35e-74 224 54 1 189 3 VV1_3058 Elongation factor P-like protein Vibrio vulnificus (strain CMCP6)
Q6LQV7 3.74e-74 224 57 1 190 3 PBPRA1915 Elongation factor P-like protein Photobacterium profundum (strain SS9)
Q87NC0 2.35e-73 222 52 1 189 3 VP1948 Elongation factor P-like protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MS04 8.44e-73 221 52 1 189 3 VIBHAR_02751 Elongation factor P-like protein Vibrio campbellii (strain ATCC BAA-1116)
A8FU94 2.49e-72 219 53 1 190 3 Ssed_1806 Elongation factor P-like protein Shewanella sediminis (strain HAW-EB3)
Q0VRR6 8.48e-72 218 53 1 189 3 ABO_0684 Elongation factor P-like protein Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3IEF7 1.18e-71 218 54 1 190 3 PSHAa0969 Elongation factor P-like protein Pseudoalteromonas translucida (strain TAC 125)
Q15SU8 3.15e-71 216 52 1 190 3 Patl_2524 Elongation factor P-like protein Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1SUX2 2.3e-68 209 49 1 190 3 Ping_1470 Elongation factor P-like protein Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B7VGT7 3.48e-68 209 53 1 189 3 VS_1959 Elongation factor P-like protein Vibrio atlanticus (strain LGP32)
Q21GV1 8.16e-68 208 51 1 189 3 Sde_2821 Elongation factor P-like protein Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q485Q8 1.47e-66 205 50 1 190 3 CPS_1465 Elongation factor P-like protein Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A6VX18 2.67e-65 201 50 1 190 3 Mmwyl1_2075 Elongation factor P-like protein Marinomonas sp. (strain MWYL1)
A1U4R4 6.03e-62 193 49 1 189 3 Maqu_2909 Elongation factor P-like protein Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q3BUD7 4.84e-50 163 42 1 188 3 XCV1895 Elongation factor P-like protein Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PLF1 7.25e-50 162 42 1 188 3 XAC1849 Elongation factor P-like protein Xanthomonas axonopodis pv. citri (strain 306)
Q5GYR2 5.2e-49 160 42 1 188 3 XOO2905 Elongation factor P-like protein Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SV69 5.2e-49 160 42 1 188 3 PXO_00104 Elongation factor P-like protein Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1R7 5.2e-49 160 42 1 188 3 XOO2755 Elongation factor P-like protein Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P9M3 1.16e-48 159 42 1 188 3 XCC1830 Elongation factor P-like protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSN5 1.16e-48 159 42 1 188 3 xcc-b100_2118 Elongation factor P-like protein Xanthomonas campestris pv. campestris (strain B100)
Q4UU61 1.16e-48 159 42 1 188 3 XC_2359 Elongation factor P-like protein Xanthomonas campestris pv. campestris (strain 8004)
B2FQ58 1.42e-47 156 40 1 188 3 Smlt2205 Elongation factor P-like protein Stenotrophomonas maltophilia (strain K279a)
B4SHS5 5.07e-47 155 39 1 188 3 Smal_1798 Elongation factor P-like protein Stenotrophomonas maltophilia (strain R551-3)
Q9PBE1 3.3e-42 143 37 1 188 3 XF_2203 Elongation factor P-like protein Xylella fastidiosa (strain 9a5c)
B0U399 2.33e-41 140 36 1 188 3 Xfasm12_1404 Elongation factor P-like protein Xylella fastidiosa (strain M12)
Q87C43 4.04e-41 140 36 1 187 3 PD_1253 Elongation factor P-like protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I5W7 4.04e-41 140 36 1 187 3 XfasM23_1338 Elongation factor P-like protein Xylella fastidiosa (strain M23)
C1F3T7 9.06e-38 131 37 2 186 3 efp Elongation factor P Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B0TEH1 1.32e-36 128 34 3 189 3 efp Elongation factor P Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A9VGY0 3.98e-36 127 36 2 189 3 efp Elongation factor P Bacillus mycoides (strain KBAB4)
B7IXI8 6.76e-36 127 36 2 189 3 efp Elongation factor P Bacillus cereus (strain G9842)
Q812U1 1.34e-35 126 36 2 189 3 efp Elongation factor P Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7HB68 1.34e-35 126 36 2 189 3 efp Elongation factor P Bacillus cereus (strain B4264)
A7GSL5 1.49e-35 125 36 2 189 3 efp Elongation factor P Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B9IXJ1 1.87e-35 125 35 2 189 3 efp Elongation factor P Bacillus cereus (strain Q1)
B7HNW0 1.87e-35 125 35 2 189 3 efp Elongation factor P Bacillus cereus (strain AH187)
Q730Z6 1.87e-35 125 35 2 189 3 efp Elongation factor P Bacillus cereus (strain ATCC 10987 / NRS 248)
C1ERR9 2.53e-35 125 35 2 189 3 efp Elongation factor P Bacillus cereus (strain 03BB102)
Q6HDW8 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634Y7 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus cereus (strain ZK / E33L)
B7JM48 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus cereus (strain AH820)
Q6KMS8 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus anthracis
A0RII7 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus thuringiensis (strain Al Hakam)
C3LKM5 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P7X5 3.94e-35 124 35 2 189 3 efp Elongation factor P Bacillus anthracis (strain A0248)
Q5FIJ4 1.88e-34 123 34 3 193 3 efp1 Elongation factor P 1 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q74FY7 2.73e-34 122 35 2 191 3 efp1 Elongation factor P 1 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q55119 5.99e-33 119 34 3 188 3 efp Elongation factor P Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q74IL7 6.97e-33 119 33 2 190 3 efp2 Elongation factor P 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B1HS10 9.03e-33 119 34 2 189 3 efp Elongation factor P Lysinibacillus sphaericus (strain C3-41)
C5D486 1.94e-32 118 35 3 191 3 efp Elongation factor P Geobacillus sp. (strain WCH70)
B7GHE5 2.36e-32 117 34 3 191 3 efp Elongation factor P Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B2GES0 2.46e-32 117 36 3 191 3 efp Elongation factor P Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q5KX91 4.32e-32 117 34 3 191 3 efp Elongation factor P Geobacillus kaustophilus (strain HTA426)
B3QW61 7.6e-32 116 34 3 190 3 efp Elongation factor P Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A0AIF6 1.48e-31 115 32 2 189 3 efp Elongation factor P Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q5FJG2 1.75e-31 115 32 2 190 3 efp2 Elongation factor P 2 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
B3E058 2.41e-31 115 32 3 189 3 efp Elongation factor P Methylacidiphilum infernorum (isolate V4)
P64032 2.56e-31 115 32 2 189 3 efp Elongation factor P Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DFX3 2.56e-31 115 32 2 189 3 efp Elongation factor P Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZW7 2.56e-31 115 32 2 189 3 efp Elongation factor P Listeria monocytogenes serotype 4b (strain F2365)
C1L2R1 2.56e-31 115 32 2 189 3 efp Elongation factor P Listeria monocytogenes serotype 4b (strain CLIP80459)
P64033 2.56e-31 115 32 2 189 3 efp Elongation factor P Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P64039 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain MW2)
A8Z468 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain USA300 / TCH1516)
Q6G937 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain MSSA476)
Q6GGH0 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain MRSA252)
P99066 2.94e-31 115 32 3 189 1 efp Elongation factor P Staphylococcus aureus (strain N315)
P64038 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH73 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain Newman)
Q5HFN0 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain COL)
Q2YT00 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IT57 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain JH9)
Q2FY41 2.94e-31 115 32 3 189 1 efp Elongation factor P Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGJ3 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain USA300)
A6U200 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain JH1)
A7X2Q9 2.94e-31 115 32 3 189 3 efp Elongation factor P Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7Z6L3 4.02e-31 114 31 2 189 3 efp Elongation factor P Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q116D6 4.29e-31 114 34 4 190 3 efp Elongation factor P Trichodesmium erythraeum (strain IMS101)
B2G967 5.15e-31 114 33 3 191 3 efp Elongation factor P Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLU9 5.15e-31 114 33 3 191 3 efp Elongation factor P Limosilactobacillus reuteri (strain DSM 20016)
Q5WF43 6.06e-31 114 33 2 189 3 efp Elongation factor P Shouchella clausii (strain KSM-K16)
A4IQT4 6.26e-31 114 34 3 191 3 efp Elongation factor P Geobacillus thermodenitrificans (strain NG80-2)
Q2RI92 8.55e-31 114 32 2 189 3 efp Elongation factor P Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q1AW08 1.04e-30 113 33 2 188 3 efp Elongation factor P Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q4L6M9 1.36e-30 113 31 2 189 3 efp Elongation factor P Staphylococcus haemolyticus (strain JCSC1435)
A8GRA8 1.57e-30 113 34 2 186 3 efp Elongation factor P Rickettsia rickettsii (strain Sheila Smith)
B0BWQ9 1.57e-30 113 34 2 186 3 efp Elongation factor P Rickettsia rickettsii (strain Iowa)
A1SJD7 1.72e-30 113 33 4 197 3 efp Elongation factor P Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q49XX3 1.74e-30 112 33 2 189 3 efp Elongation factor P Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A4X611 2.09e-30 112 33 2 189 3 efp Elongation factor P Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q65HH4 2.33e-30 112 31 2 189 3 efp Elongation factor P Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B2J711 2.86e-30 112 31 3 188 3 efp Elongation factor P Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A8FF29 3.22e-30 112 31 2 189 3 efp Elongation factor P Bacillus pumilus (strain SAFR-032)
P49778 3.43e-30 112 31 2 189 3 efp Elongation factor P Bacillus subtilis (strain 168)
C3PMT5 3.48e-30 112 34 2 186 3 efp Elongation factor P Rickettsia africae (strain ESF-5)
A1R701 3.54e-30 112 34 2 190 3 efp Elongation factor P Paenarthrobacter aurescens (strain TC1)
Q88WN1 3.7e-30 112 32 2 189 3 efp Elongation factor P Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q5N1T5 3.99e-30 112 32 3 190 3 efp Elongation factor P Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q54760 3.99e-30 112 32 3 190 3 efp Elongation factor P Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
C4K0V3 4.09e-30 112 34 2 186 3 efp Elongation factor P Rickettsia peacockii (strain Rustic)
Q4UKM7 4.09e-30 112 35 2 186 3 efp Elongation factor P Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A0JX80 4.54e-30 112 34 2 190 3 efp Elongation factor P Arthrobacter sp. (strain FB24)
Q8CP34 4.74e-30 112 31 2 189 3 efp Elongation factor P Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q9K951 5.06e-30 111 33 2 189 3 efp Elongation factor P Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7UA67 6.54e-30 111 32 3 192 3 efp Elongation factor P Parasynechococcus marenigrum (strain WH8102)
Q741J3 6.9e-30 111 31 3 190 3 efp Elongation factor P Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QI55 6.9e-30 111 31 3 190 3 efp Elongation factor P Mycobacterium avium (strain 104)
B5YDZ9 7.06e-30 111 31 3 189 3 efp Elongation factor P Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
A5D339 7.45e-30 111 33 2 188 3 efp Elongation factor P Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B8H8V3 7.69e-30 111 35 2 188 3 efp Elongation factor P Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)
C0ZBY1 8.57e-30 111 30 2 189 3 efp Elongation factor P Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q5HP20 1.02e-29 110 31 2 189 3 efp Elongation factor P Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q1RHW1 1.15e-29 110 33 2 186 3 efp Elongation factor P Rickettsia bellii (strain RML369-C)
A8GW85 1.15e-29 110 33 2 186 3 efp Elongation factor P Rickettsia bellii (strain OSU 85-389)
A4XJ18 1.38e-29 110 29 3 189 3 efp Elongation factor P Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A3DDQ3 1.78e-29 110 32 2 188 1 efp Elongation factor P Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B9MLY0 2.14e-29 110 30 3 189 3 efp Elongation factor P Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B0JHV3 3.15e-29 109 32 3 190 3 efp Elongation factor P Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A8LY10 3.62e-29 109 32 3 191 3 efp Elongation factor P Salinispora arenicola (strain CNS-205)
B1XKV1 4.21e-29 109 31 2 188 3 efp Elongation factor P Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A0QWR4 4.44e-29 109 31 3 190 1 efp Elongation factor P Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B8E240 4.69e-29 109 30 3 189 3 efp Elongation factor P Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B7JVR7 5e-29 109 31 2 188 3 efp Elongation factor P Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8EQ28 5.06e-29 109 30 2 189 3 efp Elongation factor P Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q92IU8 5.3e-29 109 34 2 186 3 efp Elongation factor P Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B0K0T5 5.4e-29 109 32 3 189 3 efp Elongation factor P Thermoanaerobacter sp. (strain X514)
B0K9C8 5.4e-29 109 32 3 189 3 efp Elongation factor P Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B2A549 5.65e-29 109 31 2 188 3 efp Elongation factor P Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A4TBX4 5.93e-29 108 32 3 190 3 efp Elongation factor P Mycolicibacterium gilvum (strain PYR-GCK)
B0C899 7.45e-29 108 30 3 188 3 efp Elongation factor P Acaryochloris marina (strain MBIC 11017)
B9DNQ4 7.69e-29 108 32 2 189 3 efp Elongation factor P Staphylococcus carnosus (strain TM300)
P9WNM3 8.28e-29 108 32 3 190 1 efp Elongation factor P Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WNM2 8.28e-29 108 32 3 190 3 efp Elongation factor P Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U5N3 8.28e-29 108 32 3 190 3 efp Elongation factor P Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AF02 8.28e-29 108 32 3 190 3 efp Elongation factor P Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KLN1 8.28e-29 108 32 3 190 3 efp Elongation factor P Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P64035 8.28e-29 108 32 3 190 3 efp Elongation factor P Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q2JP65 8.75e-29 108 33 4 190 3 efp Elongation factor P Synechococcus sp. (strain JA-2-3B'a(2-13))
Q1B9G8 1e-28 108 32 3 190 3 efp Elongation factor P Mycobacterium sp. (strain MCS)
A1UFJ5 1e-28 108 32 3 190 3 efp Elongation factor P Mycobacterium sp. (strain KMS)
A3PZ56 1e-28 108 32 3 190 3 efp Elongation factor P Mycobacterium sp. (strain JLS)
Q2JUZ8 1.06e-28 108 31 3 188 3 efp Elongation factor P Synechococcus sp. (strain JA-3-3Ab)
B1MCE5 1.12e-28 108 31 3 192 3 efp Elongation factor P Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q0AZH4 1.2e-28 108 31 2 188 3 efp Elongation factor P Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q8DJD3 1.21e-28 108 32 3 190 3 efp Elongation factor P Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A1T8F9 1.76e-28 107 31 3 190 3 efp Elongation factor P Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B2HND2 2.09e-28 107 31 3 190 3 efp Elongation factor P Mycobacterium marinum (strain ATCC BAA-535 / M)
A8F0Z8 2.44e-28 107 34 2 186 3 efp Elongation factor P Rickettsia massiliae (strain Mtu5)
A0PPH6 2.45e-28 107 31 3 190 3 efp Elongation factor P Mycobacterium ulcerans (strain Agy99)
A8EXY7 4.59e-28 107 34 2 186 3 efp Elongation factor P Rickettsia canadensis (strain McKiel)
Q3MAQ3 7.35e-28 106 30 3 188 3 efp Elongation factor P Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q74HT9 7.75e-28 106 31 3 191 3 efp1 Elongation factor P 1 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q3ANM0 8.16e-28 106 31 3 192 3 efp Elongation factor P Synechococcus sp. (strain CC9605)
A2BZC9 8.43e-28 106 33 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain NATL1A)
Q44247 1.18e-27 105 30 3 188 3 efp Elongation factor P Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q67N94 1.26e-27 105 29 3 189 3 efp Elongation factor P Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q18BA9 1.26e-27 105 30 3 188 3 efp Elongation factor P Clostridioides difficile (strain 630)
B8HV20 1.27e-27 105 30 3 190 3 efp Elongation factor P Cyanothece sp. (strain PCC 7425 / ATCC 29141)
B6INP2 1.29e-27 105 32 3 189 3 efp Elongation factor P Rhodospirillum centenum (strain ATCC 51521 / SW)
B1WNP3 1.35e-27 105 31 2 188 3 efp Elongation factor P Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q8RAE2 1.43e-27 105 30 3 189 3 efp Elongation factor P Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A2BNF2 1.53e-27 105 30 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain AS9601)
B8I3C7 2.03e-27 105 32 3 189 3 efp Elongation factor P Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B8FQ76 2.08e-27 105 30 3 189 3 efp Elongation factor P Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q46I36 2.55e-27 104 32 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain NATL2A)
B2GI94 2.55e-27 104 33 2 190 3 efp Elongation factor P Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
A3PA73 2.56e-27 104 30 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9301)
B3CQC7 2.95e-27 104 34 3 187 3 efp Elongation factor P Orientia tsutsugamushi (strain Ikeda)
Q1J530 3.2e-27 104 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q2J829 3.55e-27 104 31 2 188 3 efp Elongation factor P Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
P64041 3.62e-27 104 33 3 190 3 efp Elongation factor P Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P64040 3.62e-27 104 33 3 190 3 efp Elongation factor P Streptococcus agalactiae serotype III (strain NEM316)
Q3JZJ4 3.62e-27 104 33 3 190 3 efp Elongation factor P Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A5CDP1 3.7e-27 104 34 3 187 3 efp Elongation factor P Orientia tsutsugamushi (strain Boryong)
B7IH59 3.72e-27 104 32 3 189 3 efp Elongation factor P Thermosipho africanus (strain TCF52B)
Q3B0X4 3.81e-27 104 31 4 190 3 efp Elongation factor P Synechococcus sp. (strain CC9902)
Q3AAZ2 3.84e-27 104 29 2 189 3 efp Elongation factor P Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B5XI32 4.1e-27 104 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M49 (strain NZ131)
Q838Z5 4.99e-27 103 33 2 189 3 efp Elongation factor P Enterococcus faecalis (strain ATCC 700802 / V583)
Q24UX6 5.3e-27 103 30 3 189 3 efp Elongation factor P Desulfitobacterium hafniense (strain Y51)
C4Z157 5.65e-27 103 30 2 189 3 efp Elongation factor P Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
A8GMN6 5.66e-27 103 33 2 186 3 efp Elongation factor P Rickettsia akari (strain Hartford)
Q9KXQ9 5.9e-27 103 32 3 190 3 efp Elongation factor P Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7V9B9 6.12e-27 103 30 3 192 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9313)
C4L3G0 6.3e-27 103 34 4 193 3 efp Elongation factor P Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q31DF8 6.38e-27 103 30 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9312)
A2C5M7 6.59e-27 103 30 3 192 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9303)
A9B1H0 6.64e-27 103 33 5 189 3 efp Elongation factor P Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q48RL6 7.47e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q827R5 7.8e-27 103 31 3 190 3 efp Elongation factor P Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A8G213 7.83e-27 103 30 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9215)
P0DA87 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M3 (strain SSI-1)
A2RCS2 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1JF80 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JK85 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JA37 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M12 (strain MGAS2096)
P68775 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XA92 7.97e-27 103 31 2 189 1 efp Elongation factor P Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DA86 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P68773 7.97e-27 103 31 2 189 3 efp Elongation factor P Streptococcus pyogenes serotype M1
Q8DSE7 2.29e-26 102 33 3 190 3 efp Elongation factor P Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A5GHP3 2.37e-26 102 31 3 192 3 efp Elongation factor P Synechococcus sp. (strain WH7803)
Q9CCS0 2.5e-26 102 30 3 190 3 efp Elongation factor P Mycobacterium leprae (strain TN)
B8ZUK6 2.5e-26 102 30 3 190 3 efp Elongation factor P Mycobacterium leprae (strain Br4923)
B0REX1 2.72e-26 102 32 2 188 3 efp Elongation factor P Clavibacter sepedonicus
A5CRY6 2.72e-26 102 32 2 188 3 efp Elongation factor P Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
A2BTX3 2.93e-26 102 30 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9515)
C5CI92 3.28e-26 102 32 3 189 3 efp Elongation factor P Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q0IE51 3.64e-26 102 30 3 192 3 efp Elongation factor P Synechococcus sp. (strain CC9311)
Q030U0 4.24e-26 101 31 2 189 3 efp Elongation factor P Lactococcus lactis subsp. cremoris (strain SK11)
A2RMC2 4.24e-26 101 31 2 189 3 efp Elongation factor P Lactococcus lactis subsp. cremoris (strain MG1363)
B1I3C0 4.38e-26 101 30 2 189 3 efp Elongation factor P Desulforudis audaxviator (strain MP104C)
B1YLP7 4.72e-26 101 32 3 191 3 efp Elongation factor P Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A5FZ78 4.93e-26 101 31 3 189 3 efp Elongation factor P Acidiphilium cryptum (strain JF-5)
B2TRQ5 5.73e-26 101 29 2 188 3 efp Elongation factor P Clostridium botulinum (strain Eklund 17B / Type B)
B2V4S9 5.73e-26 101 29 2 188 3 efp Elongation factor P Clostridium botulinum (strain Alaska E43 / Type E3)
A0LUG7 6.63e-26 101 31 2 190 3 efp Elongation factor P Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
B0S053 6.73e-26 101 30 2 188 3 efp Elongation factor P Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B8G711 7.59e-26 101 28 1 184 3 efp Elongation factor P Chloroflexus aggregans (strain MD-66 / DSM 9485)
B9E6R3 8.89e-26 100 30 2 189 3 efp Elongation factor P Macrococcus caseolyticus (strain JCSC5402)
Q7V3P5 8.92e-26 100 30 3 188 3 efp Elongation factor P Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
B1KT65 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain Loch Maree / Type A3)
A7GEK9 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IMQ0 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain Okra / Type B1)
C1FPC4 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain Kyoto / Type A2)
A5I321 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KXD8 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain 657 / Type Ba4)
A7FUV2 1.21e-25 100 30 3 188 3 efp Elongation factor P Clostridium botulinum (strain ATCC 19397 / Type A)
Q5FUC7 1.25e-25 100 31 3 187 3 efp Elongation factor P Gluconobacter oxydans (strain 621H)
Q9ZDT7 1.26e-25 100 31 2 186 3 efp Elongation factor P Rickettsia prowazekii (strain Madrid E)
C1CPU3 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIT4 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain P1031)
C1CCJ8 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain JJA)
P64043 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2ILX6 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain CGSP14)
P64042 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZLJ9 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I9M6 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain Hungary19A-6)
C1C5H0 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae (strain 70585)
B5E1P5 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae serotype 19F (strain G54)
Q04M43 1.27e-25 100 32 3 190 3 efp Elongation factor P Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B7KGU8 1.36e-25 100 29 2 188 3 efp Elongation factor P Gloeothece citriformis (strain PCC 7424)
A0Q087 1.39e-25 100 31 2 188 3 efp Elongation factor P Clostridium novyi (strain NT)
A6LLA5 1.6e-25 100 31 3 189 3 efp Elongation factor P Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
B1W455 2.14e-25 100 30 3 190 3 efp Elongation factor P Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B9LAT1 2.14e-25 100 27 1 184 3 efp Elongation factor P Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WFA4 2.14e-25 100 27 1 184 3 efp Elongation factor P Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q9CHN6 2.16e-25 99 32 5 194 3 efp Elongation factor P Lactococcus lactis subsp. lactis (strain IL1403)
A5N7H7 2.62e-25 99 29 2 188 3 efp Elongation factor P Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
Q5YTL1 3.2e-25 99 30 2 190 3 efp Elongation factor P Nocardia farcinica (strain IFM 10152)
B8DTW0 3.2e-25 99 31 3 188 3 efp Elongation factor P Bifidobacterium animalis subsp. lactis (strain AD011)
A5GPX5 3.44e-25 99 29 3 190 3 efp Elongation factor P Synechococcus sp. (strain RCC307)
C5C680 4.35e-25 99 31 2 190 3 efp Elongation factor P Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
A8MFK4 4.43e-25 99 30 3 188 3 efp Elongation factor P Alkaliphilus oremlandii (strain OhILAs)
C5BNT8 4.44e-25 99 32 2 186 3 efp Elongation factor P Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q68XD1 4.62e-25 99 31 2 186 3 efp Elongation factor P Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A4FBF7 4.92e-25 99 30 2 188 3 efp Elongation factor P Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q6AF92 5.89e-25 99 31 2 190 3 efp Elongation factor P Leifsonia xyli subsp. xyli (strain CTCB07)
Q2W7T6 6.23e-25 98 31 3 186 3 efp Elongation factor P Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8A1F7 6.71e-25 98 31 3 189 3 efp Elongation factor P Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B5EPM9 6.89e-25 98 31 3 188 3 efp Elongation factor P Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J6R6 6.89e-25 98 31 3 188 3 efp Elongation factor P Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q0BT69 6.91e-25 98 31 3 189 3 efp Elongation factor P Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B3EER6 9.97e-25 98 28 2 189 3 efp Elongation factor P Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
P70889 1.03e-24 98 31 3 189 3 efp Elongation factor P Bacteroides fragilis (strain YCH46)
Q5LI35 1.03e-24 98 31 3 189 3 efp Elongation factor P Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q7NL41 1.12e-24 98 30 4 193 3 efp Elongation factor P Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
C1A9H6 1.16e-24 98 27 3 188 3 efp Elongation factor P Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q7VEI7 1.67e-24 97 29 3 190 3 efp Elongation factor P Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q30ZZ6 2.3e-24 97 31 2 188 3 efp Elongation factor P Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B1LAR0 2.35e-24 97 31 4 191 3 efp Elongation factor P Thermotoga sp. (strain RQ2)
A5ILJ5 2.35e-24 97 31 4 191 3 efp Elongation factor P Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q8FT34 2.39e-24 97 30 2 190 3 efp Elongation factor P Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B4U7D5 2.43e-24 97 30 3 188 3 efp Elongation factor P Hydrogenobaculum sp. (strain Y04AAS1)
A9B9I2 3.11e-24 97 29 3 192 3 efp Elongation factor P Prochlorococcus marinus (strain MIT 9211)
A3CL43 3.42e-24 96 31 3 190 3 efp Elongation factor P Streptococcus sanguinis (strain SK36)
Q21LT5 3.49e-24 97 29 2 186 3 efp Elongation factor P Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9RY32 3.84e-24 96 30 2 189 3 efp Elongation factor P Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q6APZ9 4.07e-24 96 28 2 189 3 efp Elongation factor P Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q9X284 4.46e-24 96 31 4 191 3 efp Elongation factor P Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A8ZVH5 4.49e-24 96 28 2 189 3 efp Elongation factor P Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q97HB8 4.92e-24 96 29 3 188 3 efp Elongation factor P Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
A6KXS5 5.11e-24 96 33 5 193 3 efp Elongation factor P Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q8KG11 5.22e-24 96 30 2 188 3 efp Elongation factor P Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q2Y9K0 5.81e-24 96 29 4 192 3 efp Elongation factor P Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A4SGK2 6.61e-24 96 29 2 188 3 efp Elongation factor P Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A6LF43 7.59e-24 95 30 2 188 3 efp Elongation factor P Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A8AZB9 7.8e-24 95 31 3 190 3 efp Elongation factor P Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
C0ZZC0 9.47e-24 95 28 2 190 3 efp Elongation factor P Rhodococcus erythropolis (strain PR4 / NBRC 100887)
B5YJ32 9.78e-24 95 30 2 178 3 efp Elongation factor P Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q45288 1.08e-23 95 30 2 190 1 efp Elongation factor P Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QEJ4 1.08e-23 95 30 2 190 3 efp Elongation factor P Corynebacterium glutamicum (strain R)
Q894F6 1.09e-23 95 29 2 188 3 efp Elongation factor P Clostridium tetani (strain Massachusetts / E88)
A9H6E1 1.41e-23 95 30 2 187 3 efp Elongation factor P Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B7GPV9 2e-23 94 31 3 189 3 efp Elongation factor P Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
Q8G818 2e-23 94 31 3 189 3 efp Elongation factor P Bifidobacterium longum (strain NCC 2705)
B3DQ29 2e-23 94 31 3 189 3 efp Elongation factor P Bifidobacterium longum (strain DJO10A)
A8LE05 2.22e-23 94 31 2 188 3 efp Elongation factor P Parafrankia sp. (strain EAN1pec)
B6J9B6 2.33e-23 94 29 2 185 3 efp Elongation factor P Coxiella burnetii (strain CbuK_Q154)
A1VDC3 2.52e-23 94 31 3 190 3 efp Elongation factor P Nitratidesulfovibrio vulgaris (strain DP4)
Q72BH0 2.52e-23 94 31 3 190 3 efp Elongation factor P Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q76G20 2.62e-23 94 30 3 189 1 efp Elongation factor P Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72JL2 2.62e-23 94 30 3 189 3 efp Elongation factor P Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q88LS0 3.39e-23 94 30 4 190 1 efp Elongation factor P Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W770 3.39e-23 94 30 4 190 3 efp Elongation factor P Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B3QQR8 3.64e-23 94 30 2 188 3 efp Elongation factor P Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A4XU74 3.99e-23 94 30 5 189 3 efp Elongation factor P Pseudomonas mendocina (strain ymp)
C0QQC2 4.25e-23 94 29 3 188 3 efp Elongation factor P Persephonella marina (strain DSM 14350 / EX-H1)
A9NGL1 4.72e-23 94 29 3 189 3 efp Elongation factor P Acholeplasma laidlawii (strain PG-8A)
Q9ZMQ5 5.06e-23 94 31 4 185 3 efp Elongation factor P Helicobacter pylori (strain J99 / ATCC 700824)
B9K846 5.14e-23 93 30 4 191 3 efp Elongation factor P Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
C4Z8W1 6.57e-23 93 28 2 188 3 efp Elongation factor P Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B1VAJ8 6.63e-23 93 26 2 190 3 efp Elongation factor P Phytoplasma australiense
A7HUY3 6.82e-23 93 27 3 190 3 efp Elongation factor P Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A0Q415 7.46e-23 93 30 2 184 3 efp Elongation factor P Francisella tularensis subsp. novicida (strain U112)
Q0S0M7 7.83e-23 93 28 2 190 3 efp Elongation factor P Rhodococcus jostii (strain RHA1)
Q1CUY2 9.19e-23 93 31 4 185 3 efp Elongation factor P Helicobacter pylori (strain HPAG1)
B6JPS3 9.19e-23 93 31 4 185 3 efp Elongation factor P Helicobacter pylori (strain P12)
C0QBX7 9.39e-23 93 26 2 190 3 efp Elongation factor P Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
C6BUE7 9.47e-23 93 29 2 188 3 efp Elongation factor P Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q17YT0 1.02e-22 92 31 4 185 3 efp Elongation factor P Helicobacter acinonychis (strain Sheeba)
B0TW77 1.04e-22 93 29 2 184 3 efp Elongation factor P Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
P56004 1.13e-22 92 31 4 185 3 efp Elongation factor P Helicobacter pylori (strain ATCC 700392 / 26695)
B2US06 1.13e-22 92 31 4 185 3 efp Elongation factor P Helicobacter pylori (strain Shi470)
B5Z9V0 1.13e-22 92 31 4 185 3 efp Elongation factor P Helicobacter pylori (strain G27)
B1J4V1 1.17e-22 92 29 4 190 3 efp Elongation factor P Pseudomonas putida (strain W619)
B0KUN5 1.17e-22 92 29 4 190 3 efp Elongation factor P Pseudomonas putida (strain GB-1)
Q2NAZ6 1.17e-22 92 29 3 184 3 efp Elongation factor P Erythrobacter litoralis (strain HTCC2594)
Q82W02 1.26e-22 92 34 5 189 3 efp Elongation factor P Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q1J163 1.37e-22 92 30 2 189 3 efp Elongation factor P Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A4J3D4 1.83e-22 92 28 2 188 3 efp Elongation factor P Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B1VDM5 1.84e-22 92 29 2 188 3 efp Elongation factor P Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
C3PGM2 1.84e-22 92 29 2 190 3 efp Elongation factor P Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q11DG9 1.92e-22 92 28 3 190 3 efp Elongation factor P Chelativorans sp. (strain BNC1)
C4LIU5 2.02e-22 92 28 3 190 3 efp Elongation factor P Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
C0MEL3 2.57e-22 92 31 2 189 3 efp Elongation factor P Streptococcus equi subsp. zooepidemicus (strain H70)
B4U161 2.57e-22 92 31 2 189 3 efp Elongation factor P Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
A5UYR6 2.58e-22 92 28 2 188 3 efp Elongation factor P Roseiflexus sp. (strain RS-1)
Q1GTJ4 2.72e-22 92 28 3 187 3 efp Elongation factor P Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q83AR4 2.76e-22 92 28 2 185 1 efp Elongation factor P Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAR1 2.76e-22 92 28 2 185 3 efp Elongation factor P Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEY9 2.76e-22 92 28 2 185 3 efp Elongation factor P Coxiella burnetii (strain Dugway 5J108-111)
B6J307 2.76e-22 92 28 2 185 3 efp Elongation factor P Coxiella burnetii (strain CbuG_Q212)
Q2RVG7 3.03e-22 91 29 3 189 3 efp Elongation factor P Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9DVJ6 3.08e-22 91 31 2 189 3 efp Elongation factor P Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C1B4I4 3.16e-22 91 27 2 190 3 efp Elongation factor P Rhodococcus opacus (strain B4)
Q47EF1 4.38e-22 91 30 5 188 3 efp Elongation factor P Dechloromonas aromatica (strain RCB)
Q2KXA0 4.38e-22 91 30 5 190 3 efp Elongation factor P Bordetella avium (strain 197N)
Q1ID35 5.46e-22 91 28 4 190 3 efp Elongation factor P Pseudomonas entomophila (strain L48)
A9IYN9 6.03e-22 91 28 3 190 3 efp Elongation factor P Bartonella tribocorum (strain CIP 105476 / IBS 506)
A7HJ78 6.22e-22 90 28 3 189 3 efp Elongation factor P Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q6G1Z7 6.57e-22 90 28 3 190 3 efp Elongation factor P Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
O67376 6.58e-22 90 30 3 186 3 efp Elongation factor P Aquifex aeolicus (strain VF5)
B5Y8M4 6.79e-22 90 25 2 189 3 efp Elongation factor P Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
A7NJE1 6.88e-22 90 27 2 188 3 efp Elongation factor P Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A1K1J9 7.95e-22 90 31 5 188 3 efp Elongation factor P Azoarcus sp. (strain BH72)
B8D2E5 9.05e-22 90 24 3 189 3 efp Elongation factor P Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q89M07 9.48e-22 90 31 3 188 3 efp Elongation factor P Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A0M298 9.79e-22 90 28 3 188 3 efp Elongation factor P Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A4J019 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NI60 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNX7 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. holarctica (strain OSU18)
B2SE64 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A5M4 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. holarctica (strain LVS)
A7N9M0 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JL2 1.14e-21 90 29 2 184 3 efp Elongation factor P Francisella tularensis subsp. tularensis (strain FSC 198)
B2V9Q7 1.15e-21 90 32 2 153 3 efp Elongation factor P Sulfurihydrogenibium sp. (strain YO3AOP1)
B2JFL0 1.15e-21 90 31 6 190 3 efp Elongation factor P Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C0MBK0 1.19e-21 90 30 2 189 3 efp Elongation factor P Streptococcus equi subsp. equi (strain 4047)
Q7VX16 1.24e-21 90 29 5 190 3 efp Elongation factor P Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7W9 1.24e-21 90 29 5 190 3 efp Elongation factor P Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WLA9 1.24e-21 90 29 5 190 3 efp Elongation factor P Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B3R1Z3 1.25e-21 90 31 6 191 3 efp Elongation factor P Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K8N9 1.25e-21 90 31 6 191 3 efp Elongation factor P Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q2NJ31 1.33e-21 90 27 2 190 3 efp Elongation factor P Aster yellows witches'-broom phytoplasma (strain AYWB)
Q13VN6 1.35e-21 90 30 6 190 3 efp Elongation factor P Paraburkholderia xenovorans (strain LB400)
Q5LU15 1.53e-21 90 30 3 189 3 efp Elongation factor P Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A6Q7Q7 1.53e-21 90 29 4 185 3 efp Elongation factor P Sulfurovum sp. (strain NBC37-1)
Q6FYN9 1.69e-21 89 27 3 190 3 efp Elongation factor P Bartonella quintana (strain Toulouse)
Q2LRN9 1.73e-21 89 26 2 189 3 efp Elongation factor P Syntrophus aciditrophicus (strain SB)
B8IS61 1.74e-21 89 32 4 187 3 efp Elongation factor P Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B0SUL4 1.83e-21 89 32 3 188 3 efp Elongation factor P Caulobacter sp. (strain K31)
A7IID0 2.02e-21 89 31 3 186 3 efp Elongation factor P Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q5M2R5 2.38e-21 89 31 3 190 3 efp Elongation factor P Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q2S413 2.97e-21 89 29 2 188 3 efp Elongation factor P Salinibacter ruber (strain DSM 13855 / M31)
Q46Z24 2.98e-21 89 31 6 191 3 efp Elongation factor P Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A9HX42 3.64e-21 89 29 5 190 3 efp Elongation factor P Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1AVI4 3.97e-21 89 27 2 185 3 efp Elongation factor P Ruthia magnifica subsp. Calyptogena magnifica
Q9HZZ2 4.2e-21 89 31 5 189 1 efp Elongation factor P Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02P14 4.2e-21 89 31 5 189 3 efp Elongation factor P Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V9K9 4.2e-21 89 31 5 189 3 efp Elongation factor P Pseudomonas aeruginosa (strain LESB58)
A6V3N9 4.2e-21 89 31 5 189 3 efp Elongation factor P Pseudomonas aeruginosa (strain PA7)
B2SZU7 4.22e-21 88 30 6 190 3 efp Elongation factor P Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B8H1A0 4.87e-21 88 31 3 188 3 efp Elongation factor P Caulobacter vibrioides (strain NA1000 / CB15N)
Q9AA85 4.87e-21 88 31 3 188 3 efp Elongation factor P Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q0VLQ4 5.84e-21 88 29 2 184 3 efp Elongation factor P Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q3K918 7.7e-21 88 28 3 190 3 efp Elongation factor P Pseudomonas fluorescens (strain Pf0-1)
B4SG07 8.46e-21 88 27 2 188 3 efp Elongation factor P Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A0RQC0 8.93e-21 87 27 3 187 3 efp Elongation factor P Campylobacter fetus subsp. fetus (strain 82-40)
Q83MW6 1.02e-20 87 26 2 189 3 efp Elongation factor P Tropheryma whipplei (strain Twist)
Q83NK8 1.02e-20 87 26 2 189 3 efp Elongation factor P Tropheryma whipplei (strain TW08/27)
Q03IW4 1.15e-20 87 31 3 190 3 efp Elongation factor P Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5LY60 1.15e-20 87 31 3 190 3 efp Elongation factor P Streptococcus thermophilus (strain CNRZ 1066)
A1BD27 1.25e-20 87 26 2 189 3 efp Elongation factor P Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q1H0G4 1.26e-20 87 30 5 188 3 efp Elongation factor P Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A9KMD6 1.51e-20 87 29 2 188 3 efp Elongation factor P Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5P4G4 1.51e-20 87 28 5 188 3 efp Elongation factor P Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2G6X5 1.7e-20 87 28 3 187 3 efp Elongation factor P Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q8FYZ5 1.77e-20 87 26 3 189 3 efp Elongation factor P Brucella suis biovar 1 (strain 1330)
A9WWI6 1.77e-20 87 26 3 189 3 efp Elongation factor P Brucella suis (strain ATCC 23445 / NCTC 10510)
A9M7K7 1.77e-20 87 26 3 189 3 efp Elongation factor P Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A5VS65 1.79e-20 87 26 3 189 3 efp Elongation factor P Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
C1DD68 1.91e-20 87 29 3 189 3 efp Elongation factor P Laribacter hongkongensis (strain HLHK9)
C5CUK1 2.31e-20 86 30 5 190 3 efp Elongation factor P Variovorax paradoxus (strain S110)
Q28M91 2.57e-20 86 29 3 189 3 efp Elongation factor P Jannaschia sp. (strain CCS1)
B3QHV4 2.66e-20 86 30 4 188 3 efp Elongation factor P Rhodopseudomonas palustris (strain TIE-1)
Q8YIW2 2.74e-20 86 26 3 189 3 efp Elongation factor P Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0REX2 2.74e-20 86 26 3 189 3 efp Elongation factor P Brucella melitensis biotype 2 (strain ATCC 23457)
P0C103 2.74e-20 86 26 3 189 3 efp Elongation factor P Brucella abortus biovar 1 (strain 9-941)
Q2YRC4 2.74e-20 86 26 3 189 3 efp Elongation factor P Brucella abortus (strain 2308)
B2S7E6 2.74e-20 86 26 3 189 3 efp Elongation factor P Brucella abortus (strain S19)
B1ZHM8 2.81e-20 86 32 4 189 3 efp Elongation factor P Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q5HVL5 3.06e-20 86 27 3 187 3 efp Elongation factor P Campylobacter jejuni (strain RM1221)
A1VYR0 3.06e-20 86 27 3 187 3 efp Elongation factor P Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PHW3 3.06e-20 86 27 3 187 3 efp Elongation factor P Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H4J1 3.06e-20 86 27 3 187 3 efp Elongation factor P Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FKX4 3.06e-20 86 27 3 187 3 efp Elongation factor P Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
B9KKM5 3.4e-20 86 31 3 188 3 efp Elongation factor P Cereibacter sphaeroides (strain KD131 / KCTC 12085)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15655
Feature type CDS
Gene yeiP
Product elongation factor P-like protein YeiP
Location 14210 - 14782 (strand: -1)
Length 573 (nucleotides) / 190 (amino acids)
In genomic island -

Contig

Accession ZDB_374
Length 116739 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2016
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01132 Elongation factor P (EF-P) OB domain
PF08207 Elongation factor P (EF-P) KOW-like domain
PF09285 Elongation factor P, C-terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0231 Translation, ribosomal structure and biogenesis (J) J Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02356 elongation factor P - -

Protein Sequence

MAKANEIKRGTAVSYNGKLLMVKDIDVQTPSARGASTLYKMRFTDVRTGQKVEERFKGDDIIETITLTRRAVQLSYVDGDEYVFMDDEDFTPYPMKKDQIEEELLFIPEEGLPGMQVLTMDGQVLALELPQTVDMEIVETTPGIKGASASARTKPATMPTGLVIQVPEYLSNGEKIRIHIAERRYMGRAD

Flanking regions ( +/- flanking 50bp)

GCTTTAAGGCCTGCTTTACTATTGATGTTCATTATGTAACGGGACAAATTATGGCAAAAGCCAATGAAATTAAACGCGGAACCGCAGTGAGCTATAACGGCAAGCTGCTGATGGTCAAAGATATCGATGTCCAGACGCCAAGTGCCCGCGGGGCCAGCACCCTGTATAAAATGCGTTTTACTGATGTCCGTACCGGTCAGAAAGTGGAAGAGCGTTTTAAAGGCGATGATATTATTGAGACCATTACCTTAACCCGCCGCGCTGTTCAGCTCTCTTATGTTGATGGTGATGAGTATGTCTTTATGGATGATGAAGACTTCACGCCGTATCCGATGAAAAAAGATCAGATCGAAGAAGAACTGCTGTTTATTCCCGAGGAAGGTCTGCCGGGTATGCAGGTACTGACAATGGATGGCCAGGTGCTGGCGCTGGAGTTACCGCAGACTGTCGATATGGAAATCGTTGAAACCACCCCGGGCATCAAGGGTGCATCCGCCAGTGCACGGACCAAACCGGCAACCATGCCGACCGGGCTGGTGATTCAGGTGCCTGAATACCTGAGTAACGGTGAAAAAATCCGCATTCATATCGCGGAACGCCGTTATATGGGCCGCGCGGATTAATTCCCGCAGCCGGTAAAAACTGCCTGTTACCGGGTTACCGGGTTACCGGT