Homologs in group_1982

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14870 FBDBKF_14870 100.0 Morganella morganii S1 mepS bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
EHELCC_15675 EHELCC_15675 100.0 Morganella morganii S2 mepS bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
NLDBIP_16205 NLDBIP_16205 100.0 Morganella morganii S4 mepS bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
HKOGLL_14755 HKOGLL_14755 100.0 Morganella morganii S5 mepS bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
F4V73_RS07670 F4V73_RS07670 91.3 Morganella psychrotolerans mepS bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
PMI_RS04080 PMI_RS04080 62.6 Proteus mirabilis HI4320 mepS bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase

Distribution of the homologs in the orthogroup group_1982

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1982

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFV7 9.5e-82 243 61 2 186 3 mepS Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase Shigella flexneri
P0AFV4 9.5e-82 243 61 2 186 1 mepS Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase Escherichia coli (strain K12)
P0AFV5 9.5e-82 243 61 2 186 3 mepS Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFV6 9.5e-82 243 61 2 186 3 mepS Murein DD-endopeptidase MepS/Murein LD-carboxypeptidase Escherichia coli O157:H7
P45296 5.34e-41 139 40 5 185 3 nlpC Probable endopeptidase NlpC homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57223 2.18e-36 127 48 1 117 3 HI_1314 Probable endopeptidase HI_1314 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P23898 1.57e-35 124 46 1 128 3 nlpC Probable endopeptidase NlpC Escherichia coli (strain K12)
P0DX27 9.55e-17 80 36 2 113 1 CDR20291_0971 Peptidoglycan hydrolase Cwl0971 Clostridioides difficile (strain R20291)
P76190 1.11e-16 78 34 5 123 1 mepH Murein DD-endopeptidase MepH Escherichia coli (strain K12)
P96740 1.72e-16 79 39 3 111 1 pgdS Gamma-DL-glutamyl hydrolase Bacillus subtilis (strain 168)
P96740 4.1e-16 78 37 3 101 1 pgdS Gamma-DL-glutamyl hydrolase Bacillus subtilis (strain 168)
P96740 9.97e-16 77 33 5 131 1 pgdS Gamma-DL-glutamyl hydrolase Bacillus subtilis (strain 168)
P54421 4.56e-15 75 39 4 118 1 lytE Probable peptidoglycan endopeptidase LytE Bacillus subtilis (strain 168)
O07532 7.67e-15 75 41 4 106 1 lytF Peptidoglycan endopeptidase LytF Bacillus subtilis (strain 168)
O31852 4.28e-14 72 37 6 125 1 cwlS D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS Bacillus subtilis (strain 168)
Q01838 1.76e-13 70 40 2 96 3 iap Probable endopeptidase p60 Listeria seeligeri
Q01837 7.69e-13 69 37 2 96 3 iap Probable endopeptidase p60 Listeria ivanovii
Q01836 9.47e-13 68 35 2 107 3 iap Probable endopeptidase p60 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P96645 1.02e-12 68 30 4 132 1 cwlT Bifunctional muramidase/DL-endopeptidase CwlT Bacillus subtilis (strain 168)
P21171 2.8e-12 67 36 2 96 1 iap Probable endopeptidase p60 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q01839 1.4e-11 65 36 2 96 3 iap Probable endopeptidase p60 Listeria welshimeri
Q65NQ9 6.72e-11 63 36 5 111 3 cwlO Peptidoglycan DL-endopeptidase CwlO Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P40767 8.1e-11 63 39 4 99 1 cwlO Peptidoglycan DL-endopeptidase CwlO Bacillus subtilis (strain 168)
Q01835 3.06e-10 61 35 2 96 3 iap Probable endopeptidase p60 Listeria grayi
Q8NNK6 4.95e-10 59 38 2 80 3 Cgl2188 Probable endopeptidase Cgl2188 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QFQ3 5.07e-10 59 38 2 80 1 cgR_2070 Probable endopeptidase cgR_2070 Corynebacterium glutamicum (strain R)
O35010 1.13e-09 59 31 4 113 1 ykfC Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase Bacillus subtilis (strain 168)
P13692 3.58e-09 58 35 0 80 3 None Protein P54 Enterococcus faecium
Q736M3 3.77e-09 58 32 2 84 1 ykfC Gamma-D-glutamyl-L-lysine dipeptidyl-peptidase Bacillus cereus (strain ATCC 10987 / NRS 248)
P67474 1.02e-08 57 36 4 105 3 BQ2027_MB2213C Probable endopeptidase Mb2213c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHU3 1.02e-08 57 36 4 105 1 Rv2190c Probable endopeptidase Rv2190c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHU2 1.02e-08 57 36 4 105 3 MT2245 Probable endopeptidase MT2245 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q47151 1.26e-08 56 27 7 157 3 yafL Probable endopeptidase YafL Escherichia coli (strain K12)
P9WHU5 4.79e-08 54 36 2 80 1 ripB Peptidoglycan endopeptidase RipB Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHU4 4.79e-08 54 36 2 80 3 ripB Peptidoglycan endopeptidase RipB Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_15635
Feature type CDS
Gene mepS
Product bifunctional murein DD-endopeptidase/murein LD-carboxypeptidase
Location 11303 - 11857 (strand: -1)
Length 555 (nucleotides) / 184 (amino acids)

Contig

Accession ZDB_374
Length 116739 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1982
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00877 NlpC/P60 family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0791 Cell wall/membrane/envelope biogenesis (M) M Cell wall-associated hydrolase, NlpC_P60 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13694 murein DD-endopeptidase / murein LD-carboxypeptidase [EC:3.4.-.- 3.4.17.13] - -

Protein Sequence

MVTSQPILRYITRIVPALIIAATLSACSTSPNSARQVQSETRTNSFILQASQDEFEQLVNNVDVKSKLMSQYASWKGVAYRLGGTTRSGIDCSAFVRQTFLDQFGMELPRSTAEQQSVGTSVKRAKLQAGDLVLFKTGKRQRHVGIYVGNDKFVHASTSNGVIVSNMTDKYWNNRYYDGRRLIK

Flanking regions ( +/- flanking 50bp)

TTTTTTAAAGTGACGTTTGTCACATAAGGACTGCAAGGGAAAACTCACACATGGTCACATCTCAACCAATTCTGAGATATATCACCCGGATTGTTCCGGCATTGATTATCGCGGCGACATTGTCAGCATGCAGTACATCTCCAAATTCAGCCCGTCAAGTTCAATCTGAAACCCGTACAAACAGCTTTATTTTGCAAGCGTCTCAGGATGAATTCGAACAGTTAGTTAATAATGTTGATGTTAAATCCAAACTGATGTCTCAGTATGCCAGCTGGAAAGGCGTTGCTTACCGCCTCGGCGGCACCACCCGCTCCGGTATTGATTGCTCCGCATTTGTCCGTCAGACTTTCCTTGACCAGTTCGGTATGGAACTGCCGCGTTCAACCGCAGAGCAGCAGTCTGTCGGCACCAGCGTAAAACGCGCTAAATTACAGGCCGGCGACCTGGTGTTATTTAAAACCGGAAAACGTCAGCGCCATGTCGGTATTTATGTCGGCAATGACAAATTTGTCCATGCATCCACTTCAAACGGTGTTATCGTCTCAAACATGACGGATAAATACTGGAACAACCGTTATTACGACGGACGCCGTTTAATTAAATAATACATTCACTCCCTTGCAGTGTATTATTTAACAAGAAAAAGCTTCCTTTT