Homologs in group_1600

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10440 FBDBKF_10440 100.0 Morganella morganii S1 trpS tryptophan--tRNA ligase
EHELCC_14775 EHELCC_14775 100.0 Morganella morganii S2 trpS tryptophan--tRNA ligase
NLDBIP_14605 NLDBIP_14605 100.0 Morganella morganii S4 trpS tryptophan--tRNA ligase
HKOGLL_13360 HKOGLL_13360 100.0 Morganella morganii S5 trpS tryptophan--tRNA ligase
F4V73_RS14135 F4V73_RS14135 96.2 Morganella psychrotolerans trpS tryptophan--tRNA ligase
PMI_RS15000 PMI_RS15000 84.8 Proteus mirabilis HI4320 trpS tryptophan--tRNA ligase

Distribution of the homologs in the orthogroup group_1600

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1600

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7NA61 0.0 615 84 0 334 3 trpS Tryptophan--tRNA ligase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9EYY6 0.0 573 80 0 332 3 trpS Tryptophan--tRNA ligase Klebsiella aerogenes
Q8ZJF2 0.0 571 78 0 336 1 trpS Tryptophan--tRNA ligase Yersinia pestis
P67588 0.0 567 79 0 332 3 trpS Tryptophan--tRNA ligase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P67589 0.0 567 79 0 332 3 trpS Tryptophan--tRNA ligase Escherichia coli O157:H7
P00954 0.0 565 79 0 332 1 trpS Tryptophan--tRNA ligase Escherichia coli (strain K12)
P0A2P2 0.0 564 78 0 332 3 trpS Tryptophan--tRNA ligase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P3 0.0 564 78 0 332 3 trpS Tryptophan--tRNA ligase Salmonella typhi
Q83JA5 0.0 561 78 0 332 3 trpS Tryptophan--tRNA ligase Shigella flexneri
P57956 0.0 542 74 0 329 3 trpS Tryptophan--tRNA ligase Pasteurella multocida (strain Pm70)
P43835 0.0 530 72 0 329 1 trpS Tryptophan--tRNA ligase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8EK12 0.0 510 70 0 329 3 trpS Tryptophan--tRNA ligase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7VPB2 2.39e-176 495 67 1 339 3 trpS Tryptophan--tRNA ligase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9KNV7 3.14e-162 459 64 2 336 1 trpS Tryptophan--tRNA ligase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5E2G5 1.07e-159 453 63 2 336 3 trpS Tryptophan--tRNA ligase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q87L13 1.33e-157 447 62 2 336 3 trpS Tryptophan--tRNA ligase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MH15 1.43e-157 447 62 2 336 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain YJ016)
Q8DCT6 1.56e-157 447 62 2 336 3 trpS Tryptophan--tRNA ligase Vibrio vulnificus (strain CMCP6)
Q7VRN5 3.07e-140 403 54 0 331 3 trpS Tryptophan--tRNA ligase Blochmanniella floridana
P57602 2.28e-138 399 53 1 329 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K941 6.39e-138 397 54 1 329 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q891C7 5.87e-134 387 55 1 338 3 trpS Tryptophan--tRNA ligase Clostridium tetani (strain Massachusetts / E88)
Q8R9X8 1.53e-130 379 56 3 328 3 trpS Tryptophan--tRNA ligase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q97LD6 7.09e-128 372 52 2 331 3 trpS Tryptophan--tRNA ligase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8Y577 2.37e-121 355 53 4 332 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q929H5 4.05e-121 355 54 3 331 3 trpS Tryptophan--tRNA ligase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P21656 7.21e-121 354 53 3 331 1 trpS Tryptophan--tRNA ligase Bacillus subtilis (strain 168)
Q8CT69 9.36e-121 353 52 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
P00953 1.4e-120 353 54 3 328 1 trpS Tryptophan--tRNA ligase Geobacillus stearothermophilus
Q5HQH4 1.46e-120 353 52 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q81TS6 1.58e-120 353 53 3 329 3 trpS Tryptophan--tRNA ligase Bacillus anthracis
Q8ERU2 2.24e-120 353 52 3 329 3 trpS Tryptophan--tRNA ligase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
P59466 2.27e-119 350 48 0 325 3 trpS Tryptophan--tRNA ligase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q71XG7 3.08e-119 350 53 4 332 3 trpS Tryptophan--tRNA ligase Listeria monocytogenes serotype 4b (strain F2365)
Q6GI89 3.5e-119 350 51 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MRSA252)
P67594 6.38e-119 349 51 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MW2)
Q6GAT0 6.38e-119 349 51 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain MSSA476)
P67593 6.38e-119 349 51 2 329 1 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain N315)
P67592 6.38e-119 349 51 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH88 6.38e-119 349 51 2 329 3 trpS Tryptophan--tRNA ligase Staphylococcus aureus (strain COL)
Q8XMQ5 6.4e-119 349 48 1 331 3 trpS Tryptophan--tRNA ligase Clostridium perfringens (strain 13 / Type A)
Q9K8Y2 5.3e-118 347 51 3 331 3 trpS Tryptophan--tRNA ligase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8D1X5 7.3e-118 347 50 2 327 3 trpS Tryptophan--tRNA ligase Wigglesworthia glossinidia brevipalpis
Q8NSJ4 1.86e-117 346 53 3 328 3 trpS Tryptophan--tRNA ligase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8FRR3 7.93e-116 342 52 3 328 3 trpS Tryptophan--tRNA ligase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q9KZA7 1.06e-115 341 53 3 332 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7MAE0 1.27e-113 335 50 2 329 3 trpS Tryptophan--tRNA ligase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q82HU1 3.92e-112 332 51 3 331 3 trpS2 Tryptophan--tRNA ligase 2 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P9WFT3 3.24e-111 330 51 3 328 1 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFT2 3.24e-111 330 51 3 328 3 trpS Tryptophan--tRNA ligase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P67591 3.24e-111 330 51 3 328 3 trpS Tryptophan--tRNA ligase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7VIP6 5.25e-109 324 46 3 338 3 trpS Tryptophan--tRNA ligase Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q830U2 1.6e-108 323 47 4 333 3 trpS Tryptophan--tRNA ligase Enterococcus faecalis (strain ATCC 700802 / V583)
Q49901 5.84e-108 322 50 4 332 3 trpS Tryptophan--tRNA ligase Mycobacterium leprae (strain TN)
Q6AGQ7 9.17e-107 318 48 3 331 3 trpS Tryptophan--tRNA ligase Leifsonia xyli subsp. xyli (strain CTCB07)
P56396 2.87e-104 311 45 2 330 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain ATCC 700392 / 26695)
Q8DHG3 4.39e-102 306 48 3 331 3 trpS Tryptophan--tRNA ligase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9ZJX4 1.66e-101 305 45 2 330 3 trpS Tryptophan--tRNA ligase Helicobacter pylori (strain J99 / ATCC 700824)
Q7VBM9 6.34e-99 298 44 2 338 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q7TV34 9.52e-98 295 46 4 337 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus (strain MIT 9313)
Q7NCG8 5.66e-97 293 45 2 329 3 trpS Tryptophan--tRNA ligase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q7TTU9 1.26e-96 293 46 4 336 3 trpS Tryptophan--tRNA ligase Parasynechococcus marenigrum (strain WH8102)
P67587 1.41e-95 290 41 1 350 3 trpS Tryptophan--tRNA ligase Brucella suis biovar 1 (strain 1330)
P67586 1.41e-95 290 41 1 350 3 trpS Tryptophan--tRNA ligase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q7V286 1.93e-95 290 44 3 334 3 trpS Tryptophan--tRNA ligase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q89W91 2.18e-94 287 43 2 343 3 trpS Tryptophan--tRNA ligase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q82E91 2.19e-94 286 45 4 330 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q92HR1 1.6e-93 284 43 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P73655 7.61e-93 283 44 3 337 3 trpS Tryptophan--tRNA ligase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q83FN1 1.82e-92 282 45 4 328 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain Twist)
Q8YXE4 1.9e-92 282 44 2 328 3 trpS Tryptophan--tRNA ligase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q98PH7 1.94e-92 281 44 4 334 3 trpS Tryptophan--tRNA ligase Mycoplasmopsis pulmonis (strain UAB CTIP)
Q4UL98 2.08e-92 281 43 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q83HC3 2.19e-92 281 45 4 328 3 trpS Tryptophan--tRNA ligase Tropheryma whipplei (strain TW08/27)
Q8CJX0 1.51e-91 280 46 4 330 3 trpS1 Tryptophan--tRNA ligase 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9AC05 4.89e-91 278 44 1 334 3 trpS Tryptophan--tRNA ligase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q98C31 1.81e-89 275 40 1 352 3 trpS Tryptophan--tRNA ligase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8RXE9 1.97e-88 274 42 3 344 1 OVA4 Tryptophan--tRNA ligase, chloroplastic/mitochondrial Arabidopsis thaliana
Q1RIE3 3.77e-88 271 43 3 330 3 trpS Tryptophan--tRNA ligase Rickettsia bellii (strain RML369-C)
Q92SI9 4.83e-88 271 40 2 350 3 trpS Tryptophan--tRNA ligase Rhizobium meliloti (strain 1021)
Q8EVV1 1.35e-87 270 43 4 331 3 trpS Tryptophan--tRNA ligase Malacoplasma penetrans (strain HF-2)
Q8UIE8 2.3e-87 270 42 1 352 3 trpS Tryptophan--tRNA ligase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q68WR2 3.74e-86 266 40 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZD76 9.79e-85 262 40 2 330 3 trpS Tryptophan--tRNA ligase Rickettsia prowazekii (strain Madrid E)
Q9UGM6 4.45e-81 253 40 3 333 1 WARS2 Tryptophan--tRNA ligase, mitochondrial Homo sapiens
O42875 2.37e-78 246 39 5 346 3 msw1 Tryptophan--tRNA ligase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3T099 2.94e-77 244 39 3 327 2 WARS2 Tryptophan--tRNA ligase, mitochondrial Bos taurus
Q9CYK1 1.58e-74 237 38 3 327 1 Wars2 Tryptophan--tRNA ligase, mitochondrial Mus musculus
Q7NAT8 4.49e-72 230 39 5 350 3 trpS Tryptophan--tRNA ligase Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q9PQW8 1.71e-71 228 39 4 326 3 trpS Tryptophan--tRNA ligase Ureaplasma parvum serovar 3 (strain ATCC 700970)
Q7MT94 5.09e-70 224 38 5 329 3 trpS Tryptophan--tRNA ligase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q86A90 2.64e-69 224 35 6 365 3 wars2 Tryptophan--tRNA ligase, mitochondrial Dictyostelium discoideum
P75510 1.68e-68 221 37 6 340 1 trpS Tryptophan--tRNA ligase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P04803 3.38e-68 221 38 8 345 1 MSW1 Tryptophan--tRNA ligase, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9RWV7 7.59e-63 206 37 7 336 3 trpS Tryptophan--tRNA ligase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
C0HKD6 4.43e-62 205 34 7 341 2 wars-2 Tryptophan--tRNA ligase, mitochondrial Caenorhabditis elegans
Q8RGA3 2.54e-59 196 37 8 337 3 trpS Tryptophan--tRNA ligase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
P47372 1.37e-57 192 34 4 344 3 trpS Tryptophan--tRNA ligase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q5HW79 5.61e-55 185 34 6 327 3 trpS Tryptophan--tRNA ligase Campylobacter jejuni (strain RM1221)
Q9PIB4 5.61e-55 185 34 6 327 1 trpS Tryptophan--tRNA ligase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9JYQ9 9e-53 180 32 7 345 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q7UQA4 1.4e-52 179 36 5 327 3 trpS Tryptophan--tRNA ligase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9JTQ0 9e-52 177 32 8 348 3 trpS Tryptophan--tRNA ligase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q7W5T6 2.34e-48 171 34 9 339 3 trpS Tryptophan--tRNA ligase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WGI7 2.34e-48 171 34 9 339 3 trpS Tryptophan--tRNA ligase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VZ05 4.63e-48 171 34 9 339 3 trpS Tryptophan--tRNA ligase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8P3Z4 2.13e-46 166 33 9 337 3 trpS Tryptophan--tRNA ligase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q9HVX6 4.77e-46 165 32 11 348 3 trpS Tryptophan--tRNA ligase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8PFH5 4.96e-46 165 33 9 337 3 trpS Tryptophan--tRNA ligase Xanthomonas axonopodis pv. citri (strain 306)
Q88NA1 9.19e-46 164 34 9 327 3 trpS Tryptophan--tRNA ligase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
O83640 2.89e-45 160 31 10 344 3 trpS Tryptophan--tRNA ligase Treponema pallidum (strain Nichols)
Q87B10 2.29e-44 160 33 10 340 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9WYW2 2.04e-43 155 32 10 338 1 trpS Tryptophan--tRNA ligase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q87WW4 3.03e-43 158 33 9 327 3 trpS Tryptophan--tRNA ligase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9PG74 1.25e-42 155 33 10 340 3 trpS Tryptophan--tRNA ligase Xylella fastidiosa (strain 9a5c)
O84589 1.79e-41 150 30 11 348 1 trpS Tryptophan--tRNA ligase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9PJF5 2.29e-40 147 30 11 349 3 trpS Tryptophan--tRNA ligase Chlamydia muridarum (strain MoPn / Nigg)
Q9CJD1 3.99e-39 144 31 11 344 3 trpS Tryptophan--tRNA ligase Lactococcus lactis subsp. lactis (strain IL1403)
Q8DWP7 3.27e-38 142 31 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E2J5 3.27e-38 142 31 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus agalactiae serotype III (strain NEM316)
Q9Z7A4 6.73e-38 141 28 11 345 3 trpS Tryptophan--tRNA ligase Chlamydia pneumoniae
O51038 1.87e-37 140 30 12 356 3 trpS Tryptophan--tRNA ligase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8Y0A1 4.96e-37 140 39 2 167 3 trpS Tryptophan--tRNA ligase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q46127 8.97e-35 133 30 10 339 3 trpS Tryptophan--tRNA ligase Clostridium longisporum
P67596 9.45e-35 132 30 12 348 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P67595 9.45e-35 132 30 12 348 3 trpS Tryptophan--tRNA ligase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q99XH4 9.95e-35 132 30 11 346 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M1
Q821H9 1.07e-34 132 27 11 347 3 trpS Tryptophan--tRNA ligase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
P0DG61 1.14e-34 132 29 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain SSI-1)
P67598 1.14e-34 132 29 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9A2 1.14e-34 132 29 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG60 1.14e-34 132 29 11 344 3 trpS Tryptophan--tRNA ligase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8DRR1 6.11e-34 130 30 13 345 3 trpS Tryptophan--tRNA ligase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9RVD6 3.61e-33 129 33 12 336 1 trpS2 Tryptophan--tRNA ligase 2 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
O67115 5.67e-17 84 40 1 87 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
O67115 6.13e-14 75 37 5 134 3 trpS Tryptophan--tRNA ligase Aquifex aeolicus (strain VF5)
Q978Y8 1.93e-09 62 29 10 207 3 trpS Tryptophan--tRNA ligase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
O26352 6.06e-09 60 26 12 311 3 trpS Tryptophan--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8TXZ2 4.14e-08 57 24 8 230 3 tyrS Tyrosine--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q58810 4.87e-08 57 30 9 240 3 trpS Tryptophan--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A2BLD4 5.59e-07 54 29 10 237 3 trpS Tryptophan--tRNA ligase Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5)
Q8TYF7 9.1e-07 53 26 13 318 3 trpS Tryptophan--tRNA ligase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q9HIW5 9.61e-07 53 31 8 169 3 trpS Tryptophan--tRNA ligase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q97ZX0 2.05e-05 49 24 10 233 3 trpS Tryptophan--tRNA ligase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
O27795 2.3e-05 49 23 10 232 3 tyrS Tyrosine--tRNA ligase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q12W06 2.71e-05 48 23 2 162 3 tyrS Tyrosine--tRNA ligase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q9Y924 4.61e-05 48 25 10 245 1 trpS Tryptophan--tRNA ligase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
O29482 6.84e-05 47 23 9 301 1 tyrS Tyrosine--tRNA ligase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A2SU89 0.000117 47 23 5 224 3 tyrS Tyrosine--tRNA ligase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q5JEP3 0.000264 46 20 7 230 3 trpS Tryptophan--tRNA ligase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q9HN83 0.000285 46 27 4 166 3 trpS1 Tryptophan--tRNA ligase 1 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q2FNA1 0.0003 45 24 10 236 3 tyrS Tyrosine--tRNA ligase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q57834 0.000409 45 24 9 221 1 tyrS Tyrosine--tRNA ligase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A3CYG9 0.000409 45 25 9 251 3 tyrS Tyrosine--tRNA ligase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)

  • Number of RefSeq hits:

General

Source Morganella morganii S3
Locus tag LHKJJB_14740
Feature type CDS
Gene trpS
Product tryptophan--tRNA ligase
Location 97115 - 98143 (strand: -1)
Length 1029 (nucleotides) / 342 (amino acids)

Contig

Accession ZDB_372
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1600
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00579 tRNA synthetases class I (W and Y)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0180 Translation, ribosomal structure and biogenesis (J) J Tryptophanyl-tRNA synthetase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01867 tryptophanyl-tRNA synthetase [EC:6.1.1.2] Aminoacyl-tRNA biosynthesis -

Protein Sequence

MSGTNTKAHKPVVFSGAQPSGELTIGNYMGALRQWVKMQDDFDCIYCIVDQHAITVRQDPAELRKRTLDTLSLYMACGLEPAKNTLFVQSHVPQHAQLGWALNCYTYFGELSRMTQFKDKSARHAENINAGLFDYPVLMAADILLYQTNQVPVGIDQKQHLELSRDIAQRFNAIYGDVFVVPDPFIPAGGSRVMALQDPTKKMSKSDDNRNNLIALLEDPKAAAKKIKRAVTDSEEPPRVIYDLENKPGVSNLLDILSGVTGKPVAALEAEFEGQMYGHLKGAVADAVSGMLTELQTRYHEIRNDDVLLNRVMKEGAEKASARAQVTLDKVHDAIGFVRRPL

Flanking regions ( +/- flanking 50bp)

CTGCTGCCTGCACTCGGGCTGCCTCCGTTAACTCATCAGGAAGGATAATCATGAGCGGAACTAACACCAAAGCACACAAACCCGTTGTATTCAGCGGCGCACAGCCTTCCGGCGAACTGACCATCGGTAACTACATGGGCGCACTGCGCCAGTGGGTAAAAATGCAGGATGATTTTGACTGCATTTACTGCATCGTTGACCAGCACGCGATCACTGTCCGTCAGGATCCGGCTGAGCTGCGCAAGCGCACACTGGATACACTGTCGCTCTATATGGCCTGTGGTCTGGAACCGGCAAAAAATACGCTGTTTGTTCAGTCCCATGTGCCGCAGCATGCACAACTGGGCTGGGCGCTGAACTGCTACACCTATTTCGGCGAACTGAGCCGCATGACACAGTTTAAAGATAAATCTGCCCGTCATGCCGAAAACATCAACGCCGGTCTGTTTGATTATCCGGTGCTGATGGCCGCAGATATCCTGCTGTATCAGACTAACCAGGTGCCGGTCGGTATCGACCAGAAACAGCATCTGGAGCTGAGCCGCGATATCGCGCAGCGCTTTAATGCCATTTACGGTGATGTGTTTGTGGTGCCGGATCCGTTTATCCCGGCGGGCGGCTCCCGTGTGATGGCGTTACAGGATCCGACGAAAAAAATGTCGAAATCCGATGATAACCGTAACAACCTGATCGCCCTGCTGGAAGATCCGAAAGCGGCAGCGAAGAAAATCAAACGCGCGGTGACAGACTCTGAAGAGCCGCCACGCGTGATTTATGATTTGGAAAATAAACCGGGCGTTTCCAACCTGCTGGATATTCTCTCTGGTGTGACCGGCAAACCGGTTGCTGCGCTGGAAGCTGAATTTGAAGGCCAGATGTACGGTCACCTGAAAGGTGCGGTGGCGGATGCGGTTTCCGGCATGCTGACAGAGTTACAGACCCGTTATCATGAGATCCGTAACGATGATGTGTTACTGAACCGTGTAATGAAAGAAGGTGCTGAGAAAGCCTCTGCCCGTGCACAGGTCACTTTGGATAAAGTGCACGACGCGATTGGTTTTGTGCGCCGTCCGCTGTAATTACATGATATACAAATAAAAATAGCGCCTTTCGGCGCTTTTTTTATCTC